Entry information : SsclGPx
Entry ID 5777
Creation 2007-08-30 (Christophe Dunand)
Last sequence changes 2007-08-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-27 (Catherine Mathe (Scipio))
Peroxidase information: SsclGPx
Name SsclGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Sclerotinia
Organism Sclerotinia sclerotiorum    [TaxId: 5180 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsclGPx
start..stop
S start..stop
BfuGPx 333 2e-119 1..172 1..172
CgraGPx01 298 1e-104 1..165 69..233
AmacrGPx01 298 1e-104 1..172 53..224
ChigGPx01 297 3e-104 1..165 73..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1924186..1924228 43 N° 2 1923797..1924047 251 N° 3 1923446..1923670 225  
complement(join(1923446..1923670,1923797..1924047,1924186..1924228))


exon

Literature and cross-references SsclGPx
DNA ref. JGI genome:   Supercontig_2.1 (1924228..1923446)
Protein sequence: SsclGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19295.84  
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSIYEFEPLNKKGEPTPLADYKGKVLLIVNTASKCGFTPQYEGLEKLYKDMKEKHGDDFVILGFPCNQFGGQDPGTDEEIQSFCQINYGVSFPMKKVDVNGDNAAPLFKWLKEEKPGLLGLQRVKWNFEKWLVGRDGKVKQRWASTTKPESLEKPILEALNETKSEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Strain="1980".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCTACTTCTATTTATGAGTTTGAACCTTTGAATAGTAAGTTCTTTTATTCACATTCATATTCATACATCTCCATCACATCCTGCATCTCCATCTATCTACCCCTCATGTTC
GCATACCTACACAAACCATTCCCACAAATCAATCAACTATACTAATCAAACTCCACTTCAGAAAAAGGCGAACCAACTCCTCTCGCAGATTACAAAGGCAAAGTCCTTTTAATCGTCAAC
ACAGCTTCCAAATGTGGTTTCACTCCTCAATACGAAGGGCTCGAGAAATTATACAAAGACATGAAGGAGAAACATGGAGATGATTTCGTAATCTTAGGATTTCCATGTAATCAATTTGGA
GGACAAGATCCGGGAACCGATGAGGAAATTCAAAGTTTCTGTCAGATTAACTATGGAGTTTCTTTTCCTATC
GTATGTTTCTCTTTCTCTTTTATTTCGCATACATGCTCTTCAGTCCCT
TCCTTTCCTGTCTTCCCCCATTAATAATAAGATCTTATATAGAACAATACGCTAACCCCTCTCTTTCTCACCTCATAGATGAAAAAAGTCGACGTAAACGGCGACAATGCAGCTCCACTC
TTCAAATGGCTCAAGGAGGAAAAACCAGGTCTTCTCGGTCTTCAACGCGTAAAGTGGAATTTCGAAAAGTGGTTGGTGGGTAGAGATGGAAAGGTTAAGCAGAGATGGGCTAGTACTACT
AAACCGGAATCTTTGGAGAAACCTATTTTGGAGGCTTTGAATGAGACGAAGTCGGAACTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTGCTACTTCTATTTATGAGTTTGAACCTTTGAATAAAAAAGGCGAACCAACTCCTCTCGCAGATTACAAAGGCAAAGTCCTTTTAATCGTCAACACAGCTTCCAAATGTGGT
TTCACTCCTCAATACGAAGGGCTCGAGAAATTATACAAAGACATGAAGGAGAAACATGGAGATGATTTCGTAATCTTAGGATTTCCATGTAATCAATTTGGAGGACAAGATCCGGGAACC
GATGAGGAAATTCAAAGTTTCTGTCAGATTAACTATGGAGTTTCTTTTCCTATC
ATGAAAAAAGTCGACGTAAACGGCGACAATGCAGCTCCACTCTTCAAATGGCTCAAGGAGGAAAAA
CCAGGTCTTCTCGGTCTTCAACGCGTAAAGTGGAATTTCGAAAAGTGGTTGGTGGGTAGAGATGGAAAGGTTAAGCAGAGATGGGCTAGTACTACTAAACCGGAATCTTTGGAGAAACCT
ATTTTGGAGGCTTTGAATGAGACGAAGTCGGAACTTTGA

Retrieve as FASTA