Entry information : GmPrx56 (Glyma19g25980.1)
Entry ID 585
Creation 2006-08-07 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx56 (Glyma19g25980.1)
Name (synonym) GmPrx56 (Glyma19g25980.1)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Mature flowers
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx56
start..stop
S start..stop
GmPrx272 623 0 1..327 1..326
MtPrx41 507 0 1..326 1..320
CclPrx43 485 2e-174 4..326 3..324
VvPrx65 483 6e-174 1..327 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32318891..32319106 216 N° 2 32320198..32320389 192 N° 3 32322357..32322929 573  
join(32318891..32319106,32320198..32320389,32322357..32322929)


exon

Literature and cross-references GmPrx56 (Glyma19g25980.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 11:   Gm19 (32318891..32322929)
Protein sequence: GmPrx56 (Glyma19g25980.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (302)
PWM (Da):   %s   34978.31 (32095.8)  
PI (pH):   %s   4.56 (4.45) Peptide Signal:   %s   cut: 26 range:26-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKIMRTVLMALLMAFTMLISKGEGQLVENFYSSSCPNVESMVKQAVTNKFTETITTGQATLRLFFHDCFVEGCDASVIISSPNGDTEKDAEENISLPGDGFDTVIKAKQAVEASCPGVVSCADILALATRDVIGLLGGPSFNVELGRRDGLISKASSVEGNLPKANFNLDQLNALFAKHGLTQTDVIALSGAHTVGFSHCDQFANRLYSFSSSNPVDPTLDPTYAQDLMAGCPRNPDPAVVLPLDPQSPAAFDNAYYQNLLSGKGLLTSDQVLFEDATSQPTVVRFANSAADFNDAFVAAMRKLGRVGVKTGKDGEIRRDCTTFNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAATCATGAGGACAGTATTAATGGCTTTGTTGATGGCTTTCACGATGCTTATATCTAAGGGTGAAGGCCAATTAGTAGAGAATTTCTATAGTTCATCTTGCCCAAACGTGGAA
TCCATGGTGAAACAAGCAGTGACTAACAAGTTTACAGAGACCATCACAACTGGACAAGCAACTCTGCGTCTCTTTTTCCATGATTGCTTTGTTGAG
GTGCCTTCTTCAATTCGCATATAT
TTCTTTAGTTCCTTAACTTGTGTGTGTATGATATAATTTTTCAGTTTCAAGTTTTGTTTTTATAAAGAAAATATAAATAATTATTACCAGCTTCATATCTATGGTTTTGTTCGTTTCCTT
CTTGATGAGCATGCATTTTGGGATATAATATTTTCCTTGTGTTTACTCTCTCTTTTAATTTTCATATAATTAAGAAGTTGAAATTTCAAAATATGATCATCGTGACTTTTATGGCTGGTG
GAGGCTTATTCTTCTTTTCGCAAGTTCGCATTTGGGATGGTAATATGGTATGCGCGACTTTCTATTTTGTGTGTGGAAAATGATAATATGATGGGAGACGTAGTCACCACACAACTGCAC
GCCTTTGGTACCGACCTAGATTATTAAAAAAAATAATTGACTACAAGGTATATACAACAATCCTACAAGTTGATGTGTTGTTAACTTTTGATCACATTCTACAATTAACACACGAACATG
CTAAAAACATTGATCATAAATCACATTCTATTTCATTCAGGAAAAAAGAAGTGTACTTATCAAAATTGACATCACTTATCATGACAATTTTGTAGATCTGCATAAAGTTAAAGTAAAATT
TAAATGGAAATGTTAGTGGCATTTTCTCTCTACACTTTTTTAACATTCTCGTGATTGGTTAAAAATTATTAAGAGCATCTTCATGCAAAAAATTTATATGAGTTTGTTAATTATCTTTTT
GTGGTCTTGGTATTATTTTTTTATGGTCCTCACCGTGTCATATCATTCATAAGAAACTCATATAAAGTTTTACTCCAATGCAAAAAATCATAAAAAACCGTAAAAAATTCAAACATTAAA
GTTTCTTATATAAGAAACTATTCTTAGTAATAAAGGAACCTATTTTGTCACATCATTATACTCCAATGCAGAAGAACTCACAAGAAATCGTTTTTTAGCTTAAGAAAATTATGAAAGCAC
CTTCCATTGGAGATGCTCTAACTTAATTAGGGTTTCACTTTTATTTAATAATTTTCTTTTTCTTACTCAGCTAATATATTAACGAAAAAATAGTTTTGATGGTGTAGGGCTGTGATGCCT
CCGTGATAATCTCCTCGCCAAATGGGGACACAGAGAAGGATGCCGAGGAAAATATTTCACTGCCAGGAGATGGGTTTGACACTGTGATCAAGGCAAAGCAAGCAGTGGAAGCTTCGTGCC
CTGGAGTGGTTTCCTGTGCAGACATTTTGGCACTTGCTACCAGAGACGTTATAGGCTTG
GTAAGCAATATTATTAATTTAACATAAACCCCAAAAGTAAAATCAATTAAATGGATTAATT
TAAAGTTAAAAACAATAGAATAATAACTAATAAGAGTTTATTTTTTATGTTTACCGTGTGCTGGAAGAATTTTACTCCATCCGTTGTCCAATTCTGTAGCAATGCATCATCAAGTTTTCT
TTTTTGTTAAGAATATTTACACATTCTTTCATATTCTCTCCTCAACACTTACCCTGGTATTAAATGAAATGTTATGTTATCCTTACGTAATGATAGAGATTTTGCCCAATAGTAGAAGAA
ATTTTTGGAAAAAGTAAACAAAAATTATTGTAAATGTTATTAAATTCGGCCCTATCCACATCTAACTCAATCAGGATATTATTAGTAATTAATTAGTCATTATCAAACTGGTTAAACCAC
GTTATAATAGTAGTATTTAAGTATGTAATAATATATATAATGCTAAAAATTAATTTGTTTTTCTGCTAAATATTACACTATTATCTATAAAATTGGTCCAAACATAAAATTGCNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATATATGATAAAGGAAAATTTTGATTTTGATCCCCAAA
ATATTTTGAAATTTAGATTTAATTCTATAAAATCAATGCATTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTATGCA
CTATCATTTAATCATGTGCTACACGAATTTGACTACATCCGTTGTGCAATTGTGTAGCAATACATCCTTAAGTTGTCTTTTTGTTAATAATTTCATGCTCTTTCATATTCTCTCTTCAAC
ACTTACTCTGCATGATATTAAAAGAAAAATTTATGTTACCCTTCGTAATGATAAGAGATTTTGCACAGTAGTAGAAGAAATGTTTTAAAAAGTAAAAAAAGAAATTATATTATGAGTATT
ATTAAATTCGGTCAGATCAACATCTAACTCAAACAGCATATTATTAGTAATTAATTAAGTCATTTTCAAACTGTCAAATGGTTAAACCACGTNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCTAAAAATTCATTCTTTTTTCTGGTGAGTGGCTGCTAAATATTACGCTATTATTTGTACAAATTGATTCAACCATAA
AACTACATATAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGA
TTTTAGTTCCTCAAAATATCTTAAATTTAGTTTTAATACTTTATAATTTAACATATTTTTAATCTCTGCATTTAACAAAAGTGATGTAATTTAAGTCCCTCTCGTTAGATTTTTGTTAGA
AACGTGTTTTTTTTTAAAAAAAAATGGAAGGAGTTAAAATATATTAATTTTTATAGGAACAAACTCTAAATTCAATATATATATATACTTTGGACCGTTTGTTTAAAATTAAAATAAGTA
TCCTATAAAAAAAATGATTGTTTCACAAACAGATAAAATTTGCTTATTGAACTAAGTAAAAAAAATTAAAACAAATATATAAAATAAAAACTACTTATCTATTTTAAAAAATACTTATTT
TAACAAATAAATCGAAACAAATCCACCCAATATTACATGATGATATATAATTGAATACCAGTTCAATAATATACTTTATAAAAACAGTCTACTCTGATTCCAATAATTATTTACTTTTTG
ATGTGGACAAATAAATAATGACACTATTTAATTTTTACATGTGGACAATACATTAATTTTAAATTCAAGGTGGTGACATTCATTTATTTATTTACAACTATCTCAGCTTGGAGGTCCTTC
ATTCAACGTAGAGCTTGGACGCAGAGACGGGCTTATTTCCAAGGCATCGAGTGTAGAAGGAAACCTTCCGAAAGCAAACTTCAATTTGGACCAACTCAACGCGCTTTTCGCCAAGCACGG
TCTGACCCAAACGGACGTGATTGCGCTCTCTGGGGCCCACACCGTTGGGTTCTCGCACTGCGATCAGTTCGCTAACCGTTTATATTCCTTTTCATCCTCCAACCCGGTGGACCCCACTCT
GGACCCCACCTATGCCCAGGATCTAATGGCGGGGTGCCCTAGGAACCCCGACCCAGCCGTAGTGCTTCCCCTGGACCCGCAATCCCCTGCGGCGTTCGACAACGCGTATTACCAAAACCT
GCTCTCCGGAAAAGGGTTGCTAACCTCAGACCAGGTTCTGTTCGAGGATGCCACGTCACAGCCCACGGTGGTGCGGTTCGCGAACAGCGCTGCGGATTTTAACGATGCGTTTGTCGCGGC
CATGAGGAAGCTCGGAAGGGTCGGGGTCAAGACTGGGAAAGATGGAGAGATTCGGAGAGATTGCACGACGTTCAATTCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAATCATGAGGACAGTATTAATGGCTTTGTTGATGGCTTTCACGATGCTTATATCTAAGGGTGAAGGCCAATTAGTAGAGAATTTCTATAGTTCATCTTGCCCAAACGTGGAA
TCCATGGTGAAACAAGCAGTGACTAACAAGTTTACAGAGACCATCACAACTGGACAAGCAACTCTGCGTCTCTTTTTCCATGATTGCTTTGTTGAG
GGCTGTGATGCCTCCGTGATAATC
TCCTCGCCAAATGGGGACACAGAGAAGGATGCCGAGGAAAATATTTCACTGCCAGGAGATGGGTTTGACACTGTGATCAAGGCAAAGCAAGCAGTGGAAGCTTCGTGCCCTGGAGTGGTT
TCCTGTGCAGACATTTTGGCACTTGCTACCAGAGACGTTATAGGCTTG
CTTGGAGGTCCTTCATTCAACGTAGAGCTTGGACGCAGAGACGGGCTTATTTCCAAGGCATCGAGTGTAGAA
GGAAACCTTCCGAAAGCAAACTTCAATTTGGACCAACTCAACGCGCTTTTCGCCAAGCACGGTCTGACCCAAACGGACGTGATTGCGCTCTCTGGGGCCCACACCGTTGGGTTCTCGCAC
TGCGATCAGTTCGCTAACCGTTTATATTCCTTTTCATCCTCCAACCCGGTGGACCCCACTCTGGACCCCACCTATGCCCAGGATCTAATGGCGGGGTGCCCTAGGAACCCCGACCCAGCC
GTAGTGCTTCCCCTGGACCCGCAATCCCCTGCGGCGTTCGACAACGCGTATTACCAAAACCTGCTCTCCGGAAAAGGGTTGCTAACCTCAGACCAGGTTCTGTTCGAGGATGCCACGTCA
CAGCCCACGGTGGTGCGGTTCGCGAACAGCGCTGCGGATTTTAACGATGCGTTTGTCGCGGCCATGAGGAAGCTCGGAAGGGTCGGGGTCAAGACTGGGAAAGATGGAGAGATTCGGAGA
GATTGCACGACGTTCAATTCG

Retrieve as FASTA