Entry information : NcDyPrx
Entry ID 5888
Creation 2007-10-22 (Christophe Dunand)
Last sequence changes 2012-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Catherine Mathe (Scipio))
Peroxidase information: NcDyPrx
Name NcDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcDyPrx
start..stop
S start..stop
NtetDyPrx01_2509 1012 0 1..513 1..513
NtetDyPrx01_2508 1011 0 1..513 1..513
SmaDyPrx 913 0 1..513 1..513
NdisDyPrx 879 0 1..513 1..518
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5849607..5849650 44 N° 2 5849717..5849954 238 N° 3 5850013..5850389 377 N° 4 5850449..5850541 93
N° 5 5850606..5850716 111 N° 6 5850776..5850873 98 N° 7 5850930..5851510 581  
join(5849607..5849650,5849717..5849954,5850013..5850389,5850449..5850541,5850606 ..5850716,5850776..5850873,5850930..5851510)


exon

Literature and cross-references NcDyPrx
Literature Galagan,J.E., et al.,. The genome sequence of the filamentous fungus Neurospora crassa OR74A. Nature 422 (6934), 859-868 (2003).
Protein ref. GenPept:   XP_959154 UniProtKB:   Q7S3A4   Q870R4 [Different splicing]
DNA ref. JGI genome:   supercont10.1 (5849607..5851510)
mRNA ref. GenBank:   XM_954061
Cluster/Prediction ref. JGI gene:   8015
Protein sequence: NcDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   513
PWM (Da):   %s   57939.43  
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWVARKANIQGDVWPGLPKRFQTFLFFKIRKPDEFKTRLRSFVDEHITTAQEACDMKNQILAAKTKAKDSGVPAKILPLPGVNIAFASTGLALGKFTFNEAAVKKDRNLSKIFKKNQLRGGLFGKGMYDDLVGEGWDEPKELRSQFKPSAGKRLIDGVLMVTASRAEDLRYKVLRVKEHFLKEPGSDDPDTVRYSNDPCLEFPFTSQGRTRPEKGKEHFGFEDGISQPLIEGLDEVAPKDKEPKAVKSGLIFARHDGDPMNQPEWAEDGSFLVIRDLQQLVPEFEKWLEDNKHNAPFAADSDDPKEKLAAYLMGRWRGTPVDESPHHDKDPNLFRSNNFDFHPVDKHDKCPFAAHIRKMRPRGDLNHDHAVIIRRGISYGDEVTPEEKAAQKSSEEKERGLMFVCYQSDIRNGFNFLTTRWASNHHFPDRKANFVGEHGPGIDAIVGQRLNHHPERSIGLPDGKHPTEARIGLDRWVIPRGGEYFFTPSIKAMKEYLTGPPDYPPELAGP

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). No EST. Strain="OR74A / ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGGTTGCGAGGAAAGCCAATATTCAGGGTGACGTCTGGTAAGTCTCGCTAGACTGCACATTCTTTTGAGATGTCATGGTTTGCTGATTCTTCTTCCCCATTAGGCCCGGCCTG
CCAAAAAGGTTCCAGACCTTCCTATTCTTCAAGATCAGGAAGCCAGATGAATTCAAGACGCGACTCCGATCTTTCGTGGATGAACATATCACCACGGCCCAGGAGGCTTGTGACATGAAG
AACCAGATCTTGGCGGCAAAGACAAAAGCCAAGGACAGTGGTGTCCCGGCCAAGATTCTGCCCTTGCCAGGCGTCAACATTGCCTTTGCCTCGACTGGTCTAGCAGCT
GTAAGTTATACC
TAGCCAAGGCGCCGTGCTAGAGAGACTCGCTAACTGATTACATTAGCTGGGAAAATTCACCTTCAACGAGGCCGCCGTCAAGAAGGACAGAAATCTATCCAAGATCTTCAAGAAGAACCA
GCTCCGTGGTGGCTTGTTCGGGAAGGGCATGTATGATGACCTGGTGGGTGAGGGCTGGGACGAGCCGAAAGAGCTTCGATCACAGTTCAAGCCGTCTGCGGGAAAGCGGCTGATTGATGG
CGTGCTGATGGTAACGGCGAGTCGTGCGGAAGACTTGAGATACAAAGTCCTTCGCGTCAAGGAACACTTCCTTAAGGAGCCGGGCAGTGATGATCCTGATACTGTTCGGTACAGCAATGA
CCCCTGCCTTGAGTTCCCGTTCACCAGCCAGGGTCGAACTCGTCCTGAAAAGGGCAAGGAACA
GTAAGTCTGCTTCGTACAATTGCCTATGATGACCAGCACAGACTGACCGAGATTTTC
AGCTTCGGCTTCGAGGACGGCATTAGCCAGCCCTTGATCGAGGGATTGGATGAAGTGGCGCCCAAGGACAAAGAGCCAAAGGCTGTCAAGTCAGGGTAAGGTGTTCCGGAGCTTGTCGGT
ATTGATTATCGGAACTGACAAAGTGTATTCGGATTGCAGATTGATCTTCGCCAGACACGACGGCGACCCTATGAACCAGCCGGAATGGGCCGAAGACGGCAGTTTCCTCGTGATCCGTGA
CCTTCAACAGCTCGTCCCTGAGTTTGAGAA
GTAAGTTTTTCTATGCGTCGGGAGTAGAGTCAGTCAGTACTAACTGAACACAACTTCAGGTGGCTCGAAGACAACAAACACAATGCGCCG
TTCGCCGCGGACTCTGATGACCCGAAGGAAAAGCTTGCAGCGTATCTGATGGGCAGATGGAGGAACG
GTACGTGTCCATCTATCAAGTCCCAAGCTCATTTTGCTCATGAACATTCACAA
TAGGAACCCCCGTCGACGAGAGCCCTCACCACGACAAAGACCCAAACCTTTTCCGATCCAACAACTTTGACTTCCACCCTGTCGACAAGCACGACAAATGCCCCTTTGCAGCTCACATCC
GCAAGATGCGGCCCCGCGGCGACCTGAACCACGATCACGCGGTTATCATCCGTCGTGGCATCTCCTACGGAGACGAAGTGACGCCTGAAGAAAAGGCCGCACAGAAGTCTTCTGAGGAGA
AGGAGCGCGGCTTGATGTTCGTGTGCTACCAGAGTGACATCCGCAACGGATTCAACTTCTTGACCACCCGCTGGGCTAGCAACCACCACTTCCCGGACCGCAAGGCGAACTTTGTTGGCG
AGCACGGTCCCGGTATCGATGCCATTGTGGGCCAGAGGCTTAATCACCACCCGGAGCGCTCTATCGGTCTGCCTGATGGCAAGCATCCTACTGAGGCGCGCATTGGACTCGACCGCTGGG
TGATCCCACGAGGTGGTGAATACTTCTTCACGCCATCCATCAAGGCAATGAAGGAGTATCTGACTGGCCCCCCTGATTATCCGCCAGAGCTTGCCGGCCCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGGTTGCGAGGAAAGCCAATATTCAGGGTGACGTCTGGCCCGGCCTGCCAAAAAGGTTCCAGACCTTCCTATTCTTCAAGATCAGGAAGCCAGATGAATTCAAGACGCGACTC
CGATCTTTCGTGGATGAACATATCACCACGGCCCAGGAGGCTTGTGACATGAAGAACCAGATCTTGGCGGCAAAGACAAAAGCCAAGGACAGTGGTGTCCCGGCCAAGATTCTGCCCTTG
CCAGGCGTCAACATTGCCTTTGCCTCGACTGGTCTAGCAGCT
CTGGGAAAATTCACCTTCAACGAGGCCGCCGTCAAGAAGGACAGAAATCTATCCAAGATCTTCAAGAAGAACCAGCTC
CGTGGTGGCTTGTTCGGGAAGGGCATGTATGATGACCTGGTGGGTGAGGGCTGGGACGAGCCGAAAGAGCTTCGATCACAGTTCAAGCCGTCTGCGGGAAAGCGGCTGATTGATGGCGTG
CTGATGGTAACGGCGAGTCGTGCGGAAGACTTGAGATACAAAGTCCTTCGCGTCAAGGAACACTTCCTTAAGGAGCCGGGCAGTGATGATCCTGATACTGTTCGGTACAGCAATGACCCC
TGCCTTGAGTTCCCGTTCACCAGCCAGGGTCGAACTCGTCCTGAAAAGGGCAAGGAACA
CTTCGGCTTCGAGGACGGCATTAGCCAGCCCTTGATCGAGGGATTGGATGAAGTGGCGCCC
AAGGACAAAGAGCCAAAGGCTGTCAAGTCAGG
ATTGATCTTCGCCAGACACGACGGCGACCCTATGAACCAGCCGGAATGGGCCGAAGACGGCAGTTTCCTCGTGATCCGTGACCTTCAA
CAGCTCGTCCCTGAGTTTGAGAA
GTGGCTCGAAGACAACAAACACAATGCGCCGTTCGCCGCGGACTCTGATGACCCGAAGGAAAAGCTTGCAGCGTATCTGATGGGCAGATGGAGGAAC
G
GAACCCCCGTCGACGAGAGCCCTCACCACGACAAAGACCCAAACCTTTTCCGATCCAACAACTTTGACTTCCACCCTGTCGACAAGCACGACAAATGCCCCTTTGCAGCTCACATCCGC
AAGATGCGGCCCCGCGGCGACCTGAACCACGATCACGCGGTTATCATCCGTCGTGGCATCTCCTACGGAGACGAAGTGACGCCTGAAGAAAAGGCCGCACAGAAGTCTTCTGAGGAGAAG
GAGCGCGGCTTGATGTTCGTGTGCTACCAGAGTGACATCCGCAACGGATTCAACTTCTTGACCACCCGCTGGGCTAGCAACCACCACTTCCCGGACCGCAAGGCGAACTTTGTTGGCGAG
CACGGTCCCGGTATCGATGCCATTGTGGGCCAGAGGCTTAATCACCACCCGGAGCGCTCTATCGGTCTGCCTGATGGCAAGCATCCTACTGAGGCGCGCATTGGACTCGACCGCTGGGTG
ATCCCACGAGGTGGTGAATACTTCTTCACGCCATCCATCAAGGCAATGAAGGAGTATCTGACTGGCCCCCCTGATTATCCGCCAGAGCTTGCCGGCCCTTGA

Retrieve as FASTA