Entry information : SsclDyPrx
Entry ID 5890
Creation 2007-10-22 (Christophe Dunand)
Last sequence changes 2007-10-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-27 (Catherine Mathe (Scipio))
Peroxidase information: SsclDyPrx
Name SsclDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Sclerotinia
Organism Sclerotinia sclerotiorum    [TaxId: 5180 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsclDyPrx
start..stop
S start..stop
BfuDyPrx 803 0 1..510 1..513
NcDyPrx 775 0 1..510 1..513
SmaDyPrx 774 0 1..510 1..513
NtetDyPrx01_2508 773 0 1..510 1..513
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38747..38790 44 N° 2 38452..38686 235 N° 3 38023..38393 371 N° 4 37876..37968 93
N° 5 37697..37807 111 N° 6 37547..37644 98 N° 7 36906..37498 593  
complement(join(36906..37498,37547..37644,37697..37807,37876..37968,38023..38393 ,38452..38686,38747..38790))


exon

Literature and cross-references SsclDyPrx
Literature The Broad Institute Genome Sequencing Platform. Birren B., et al., Annotation of the Sclerotinia sclerotiorum 1980 genome.
Protein ref. GenPept:   EDN98532 UniProtKB:   A7F711
DNA ref. JGI genome:   Supercontig_2.25 (38790..36906)
Protein sequence: SsclDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   514
PWM (Da):   %s   58515.66  
PI (pH):   %s   7.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWIARKSNIQGDIWPGLPKRFQTFLFFKIKKPDEFKQRLRSFAKNITTANDVCVMKDQISAAKLEAQKLRQSAKTLALPGVNIAFASTGLALGKFSFKDAEVKRNQEFYTKFKNNQLRGGLFRKGMYDDLVNEGWDNPEEIRDEYSPSKHWIDGVFLVTASLQGALENQVNRVKEHFLKVDGRGDANNYEISNDPAIEFIFDKQGKTRPEKGKEHFGFEDGISQPLIEGLDEVTPKDKEPKSVKSGLIFAKHPGDKMKQPDWAEDGSFLVFRDLQQLVPEFDKWLEDNKEHAPNAKMSEDPKEKLAAYLMGRWKGTPVDENPHDDKDKNLFRSNNFDFHPIENHDKCPFAAHIRKMRPRGDLDHDHTVIIRRSISYGDEVTPKEELEQKSDDKKQRGLLFVCYQSDIREGFNFLTTRWASSHHFPDGKGKFVGEHGPGIDAIVGQRQACHPPRSIGLPDGKVPTEARLQLEQWVIHRGGEYFFSPSIKALEGYLTDGPDYPPEITAPRPLI

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGATAGCTAGAAAGTCTAATATCCAAGGTGATATTTGGTGAGCACTTATAACCATCCCCTTCCAACATATCTTTCTTACCAATTGTTTTCTCATTAGGCCCGGACTGCCCAAA
AGATTCCAAACATTTCTGTTTTTTAAGATCAAGAAACCAGACGAGTTCAAGCAGCGGCTGCGATCTTTTGCGAAGAATATCACGACTGCAAATGATGTATGTGTTATGAAGGACCAGATC
AGCGCGGCGAAACTTGAAGCTCAAAAGTTGCGTCAATCGGCCAAGACTCTAGCCTTGCCAGGTGTCAATATTGCATTTGCCTCGACTGGTCTAGCAGCT
GTAAGTTACTCCCTATACCCC
TAAAGATTTGAATGCCACCGTTGACGAATCTCATTAGCTGGGTAAATTCTCCTTTAAAGATGCTGAGGTGAAGCGAAATCAAGAGTTTTACACAAAATTCAAGAATAATCAACTTCGTGG
TGGTTTGTTCAGGAAGGGCATGTATGACGACCTCGTAAATGAGGGCTGGGACAACCCCGAGGAGATTCGAGATGAATATTCCCCATCAAAGCATTGGATCGATGGAGTATTTTTGGTCAC
AGCCAGCCTCCAGGGCGCTTTGGAGAACCAGGTAAATCGTGTTAAAGAACATTTTCTCAAGGTGGATGGCCGTGGTGATGCCAATAACTATGAAATCAGTAATGACCCAGCGATTGAGTT
CATATTTGATAAACAAGGCAAAACTCGTCCGGAAAAGGGCAAAGAGCA
GTGAGTACTTTCAAACATATAACGAAATTCGATATATTCTAACTTGTACCATAGCTTTGGGTTTGAGGATGG
AATCAGTCAACCGCTTATCGAAGGCCTGGATGAAGTGACACCCAAAGACAAGGAGCCCAAGTCTGTGAAGTCAGG
GTAAGAGCTTCTTAATATTAATTTACTTAGGTCATCTCAGTTGAC
CAAAGGGTGACCCTGCCTTGCAGATTAATCTTCGCGAAGCACCCTGGTGATAAAATGAAGCAGCCAGATTGGGCGGAAGACGGGAGTTTCCTCGTTTTCCGAGATCTGCAACAACTTGTT
CCGGAGTTCGACAA
GTAAGTTGCTGTGCTTCTTTTATGATAAGCGAACTAATGGAGACATTATTAGATGGTTAGAAGATAACAAAGAGCATGCGCCAAATGCTAAGATGTCTGAGGACCC
GAAAGAGAAGCTTGCTGCATACCTGATGGGCCGATGGAAGAATG
GTGGGTATATCCGACTTCGATTTGATCGGCCGTTAATTGACTAATCAGGTACCCCCGTCGATGAAAACCCCCATGA
CGATAAAGATAAGAACCTTTTCCGTTCCAACAACTTTGACTTCCATCCCATCGAAAACCACGATAAGTGTCCCTTTGCAGCCCATATCCGAAAGATGCGACCTCGTGGAGACTTAGACCA
TGATCATACTGTCATCATCCGTCGCAGCATTTCTTATGGAGATGAAGTAACACCAAAAGAAGAGCTCGAACAAAAATCGGATGATAAGAAACAACGTGGTCTTCTGTTTGTCTGCTATCA
GAGCGATATCCGCGAGGGATTCAACTTCTTAACTACTCGCTGGGCAAGCAGTCACCACTTTCCGGATGGCAAGGGTAAATTTGTCGGTGAACATGGCCCTGGCATTGATGCGATTGTGGG
TCAACGACAGGCTTGCCATCCACCTCGTTCTATCGGGTTACCAGATGGTAAGGTTCCTACGGAGGCTCGCCTTCAGCTCGAACAATGGGTAATTCACAGAGGTGGTGAATACTTCTTCTC
GCCGAGTATCAAGGCCCTCGAAGGATATTTGACCGATGGTCCTGATTATCCGCCTGAGATTACAGCTCCACGACCATTAATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGATAGCTAGAAAGTCTAATATCCAAGGTGATATTTGGCCCGGACTGCCCAAAAGATTCCAAACATTTCTGTTTTTTAAGATCAAGAAACCAGACGAGTTCAAGCAGCGGCTG
CGATCTTTTGCGAAGAATATCACGACTGCAAATGATGTATGTGTTATGAAGGACCAGATCAGCGCGGCGAAACTTGAAGCTCAAAAGTTGCGTCAATCGGCCAAGACTCTAGCCTTGCCA
GGTGTCAATATTGCATTTGCCTCGACTGGTCTAGCAGCT
CTGGGTAAATTCTCCTTTAAAGATGCTGAGGTGAAGCGAAATCAAGAGTTTTACACAAAATTCAAGAATAATCAACTTCGT
GGTGGTTTGTTCAGGAAGGGCATGTATGACGACCTCGTAAATGAGGGCTGGGACAACCCCGAGGAGATTCGAGATGAATATTCCCCATCAAAGCATTGGATCGATGGAGTATTTTTGGTC
ACAGCCAGCCTCCAGGGCGCTTTGGAGAACCAGGTAAATCGTGTTAAAGAACATTTTCTCAAGGTGGATGGCCGTGGTGATGCCAATAACTATGAAATCAGTAATGACCCAGCGATTGAG
TTCATATTTGATAAACAAGGCAAAACTCGTCCGGAAAAGGGCAAAGAGCA
CTTTGGGTTTGAGGATGGAATCAGTCAACCGCTTATCGAAGGCCTGGATGAAGTGACACCCAAAGACAAG
GAGCCCAAGTCTGTGAAGTCAGG
ATTAATCTTCGCGAAGCACCCTGGTGATAAAATGAAGCAGCCAGATTGGGCGGAAGACGGGAGTTTCCTCGTTTTCCGAGATCTGCAACAACTTGTT
CCGGAGTTCGACAA
ATGGTTAGAAGATAACAAAGAGCATGCGCCAAATGCTAAGATGTCTGAGGACCCGAAAGAGAAGCTTGCTGCATACCTGATGGGCCGATGGAAGAATGGTACCCCC
GTCGATGAAAACCCCCATGACGATAAAGATAAGAACCTTTTCCGTTCCAACAACTTTGACTTCCATCCCATCGAAAACCACGATAAGTGTCCCTTTGCAGCCCATATCCGAAAGATGCGA
CCTCGTGGAGACTTAGACCATGATCATACTGTCATCATCCGTCGCAGCATTTCTTATGGAGATGAAGTAACACCAAAAGAAGAGCTCGAACAAAAATCGGATGATAAGAAACAACGTGGT
CTTCTGTTTGTCTGCTATCAGAGCGATATCCGCGAGGGATTCAACTTCTTAACTACTCGCTGGGCAAGCAGTCACCACTTTCCGGATGGCAAGGGTAAATTTGTCGGTGAACATGGCCCT
GGCATTGATGCGATTGTGGGTCAACGACAGGCTTGCCATCCACCTCGTTCTATCGGGTTACCAGATGGTAAGGTTCCTACGGAGGCTCGCCTTCAGCTCGAACAATGGGTAATTCACAGA
GGTGGTGAATACTTCTTCTCGCCGAGTATCAAGGCCCTCGAAGGATATTTGACCGATGGTCCTGATTATCCGCCTGAGATTACAGCTCCACGACCATTAATATAA

Retrieve as FASTA