Entry information : GmPrx85 (GMIPER1 / Glyma15g13500.1)
Entry ID 6
Creation 2006-10-30 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx85 (GMIPER1 / Glyma15g13500.1)
Name (synonym) GmPrx85 (GMIPER1 / Glyma15g13500.1)
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Cotyledons
Germinating seeds
Germinating shoots
Hypocotyls
Plumules
Roots
Seedlings
Shoots
Inducers Pathogen interaction
Phytophthora infection
Sudden Death Syndrome disease
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx85
start..stop
S start..stop
GmPrx08 660 0 1..354 1..355
MtPrx10 582 0 1..354 1..353
MsPrx02 563 0 1..354 1..355
MtPrx11 561 0 1..354 1..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10109862..10110083 222 N° 2 10111287..10111478 192 N° 3 10111831..10111996 166 N° 4 10112213..10112694 482
join(10109862..10110083,10111287..10111478,10111831..10111996,10112213..10112694 )


exon

Literature and cross-references GmPrx85 (GMIPER1 / Glyma15g13500.1)
Literature Yi,S.Y. and Hwang, B.K. Molecular cloning and characterization of a new basic peroxidase cDNA from soybean hypocotyls infected with Phytophthora sojae f.sp.glycines Mol. Cells 8 (5), 556-564 (1998).
Protein ref. UniProtKB:   O23961
DNA ref. Phytozome 11:   Gm15 (10109862..10112694)
Protein sequence: GmPrx85 (GMIPER1 / Glyma15g13500.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (327)
PWM (Da):   %s   38547.72 (35625.1) Transmb domain:   %s   i3-25o
PI (pH):   %s   7.1 (7.06) Peptide Signal:   %s   cut: 28 range:28-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSFHLTVTALCCVVVVLGVLPLSLDAQLDPSFYRDTCPRVHSIVREVVRNVSKKDPRMLASLIRLHFHDCFVQGCDASVLLNNTATIESEQQALPNNNSLRGLDVVNDIKTAVEKACPGVVSCADILTLASEISSVLGGGPDWKVPLGRRDSLTANRNLANQNLPAPFFNLSRLKSAFAVQGLDTTDLVALSGAHTFGRAHCNFILDRLYNFSGTGKPDPTLDTTYLQQLRQICPNGGPNNLVNFDPVTPDKIDRVYFSNLQVKKGLLQSDQELFSTPGADTIPIVNRFSSDQKVFFDAFEASMIKMGNIGVLTGKKGEIRKHCNFVNKKSVEVDIASVASEESSTEGMVTSI*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 19 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCTTTCCATCTCACAGTGACAGCTTTGTGCTGTGTAGTGGTTGTGCTTGGAGTGCTTCCACTCTCCCTAGATGCACAACTAGATCCCTCCTTTTACAGAGACACTTGTCCCAGG
GTTCACTCCATTGTTCGTGAAGTCGTCAGGAACGTTTCAAAGAAAGATCCCCGTATGCTTGCTAGTCTCATTAGACTTCACTTTCATGACTGCTTTGTTCAA
GTACGTTTACTCATCATC
ATTTTTAACTAAGTTTCAAGTGACTTCTTCACTTTTATTATTTCTTTTAAGTTTTATCTGCTAATCATATAATATGTATGTGTATTTGTCTATCCCTTGCAAGTAATTTTCAAGGGAATA
AACAACAAAAATATCTATATCAATGGGTCATACATAACTAAATTTGACCGTGCACTTTAGCCACATGTCTTTGTTTTAGCAAGATATACGTGAAAATCATACACTATAAGATATCAGAAA
ATACCACCATTTCCCTGATCTTAAAGGACAGGTCTTTTGGAGGCCTCCACTCACCACTTCTAATAAATAATAGTATTATGCATGATGCAATGCATGATGCATGGGACCACTTTCATTCTC
AACCATTGGTGCTTTGAAGGGTTTAATTTATGGAGGGAGTACTGGTGGGCTATGTTATATAACCTCCTTTTCCGTATGATTCAATCTCATCTCATTATGACCTCCTTTTTTTTCATGATT
CTTAAGAATATTTATAACGTTTGATTCCCGGGCATTCATAGAGAGAAAAACAAAGATAAACGTAATAAGTGAAATGATAGGATTAAAAAAATAACATAAGAGAAGAATAAAGTATGAAAA
AGTGTCAGATGAGATTTTCATAATGGACAAGCTAGTTTCCAAAATTAAAAGCTCCAAATTTTTTCTTTTTTTACTTTTCCTCACTAATTTTATAATATTTTTTTTACAATATTTCTTTCT
CTGTCTTACTTCACTGTATCATTTATTTTATATTCCACTTTTCTTCTTTTCGATCCATATTGTGAAAATTATTAAGAATTACATCACTTATTCTTTACCTATATATTATTTTGAACCCTC
TGTCATTGTTTTGTTTTTTTTTTTGTTTGAATAAATATAGTTAAAGAAAAAAGAGTGATGTACTATCAGTGTAAAAAGTCTTCAAGTAATTAAAGCAGTAATTTATGGTTGAATAATATA
TAAATATTAAACTCATAGTTGAAAATTAAAATAGTAAAATTCAATTATCTTCACGTCAAGGAATGTCATCTTCTGTGAGAACATGTTCCCTTTTTCAATCACTCTAAAATCTGATCAATC
AGAAGTTGATTTACCAATTGATGTCGATCGATCATATATGTAGTTGTTGAGAATGAACAAGAAATATGAATTGATTATGTTATTGATTTTTGTGGCATGCTACAGGGATGTGATGCATCA
GTTTTGTTGAACAACACTGCCACCATAGAGAGCGAGCAACAAGCTCTGCCAAACAACAACTCACTAAGAGGTTTGGATGTTGTGAACGACATTAAGACAGCAGTGGAAAAGGCTTGTCCC
GGCGTGGTTTCTTGTGCTGATATTCTTACCCTTGCATCCGAAATATCTTCTGTTCTG
GTATAAATTAATGCTATCTCTTATTCATTTTGCTTCTGTGCTGAGAATAAAATCACATTATAT
ATATGTTTCAATGTTTGACAAATATTTAATTTCGAGAGTAGAGTTTAGATAGAATCATTATCATAAAGTATACTAACCAAAAGGTTGCAATCAATTAGAAATGATATGTCTAAGGTGGTT
TCTGAGTTACTCCTTCTAATCATATTTAAATGCCATCATGATCTTTTTCTAACATTGATTATTACATAGCTCAAAGTCTATATTATTATTAGTCATGTTCAATTAAGAACACCTTTTACT
TTATTGGTCTTAAAATGATACTATATCTTACAAGTATGTATTAATATAGGGTGGTGGTCCTGATTGGAAAGTTCCATTGGGAAGAAGAGATAGTTTAACAGCAAACCGAAACCTTGCAAA
TCAAAACCTTCCAGCTCCATTCTTCAACCTATCTCGACTTAAATCTGCCTTTGCTGTTCAAGGTCTTGACACCACTGATCTAGTTGCACTCTCAG
GTAAGAATTTTTTTCCCAATTAAAT
TCATCCTATATGTTGCAACAATTAAAATAATAAGAATAATAAATAAGGAATTTCTTGAAATTCAGGGTAAGGTAATATATTAGATTCAAAGGGATATATTATTAATGAAACCATAAATTA
ACATTACTCTAGGAAAAAGAAAGTCCATGATGGATTGATTAGTATATGATTCACACAAGATTCAATTTCAGGTGCTCATACATTCGGCAGAGCTCACTGCAATTTCATTCTTGACCGATT
GTACAATTTCAGTGGAACTGGCAAACCTGATCCAACTCTTGACACAACTTACTTACAACAATTGCGCCAAATATGCCCCAATGGTGGACCTAACAACCTTGTCAATTTTGACCCTGTCAC
TCCTGATAAAATTGACAGGGTCTACTTCTCCAATCTTCAGGTTAAGAAGGGCTTGCTTCAGAGTGATCAAGAGCTGTTCTCGACACCTGGTGCCGATACCATCCCCATTGTCAACAGGTT
CAGCAGTGACCAGAAAGTTTTCTTTGACGCCTTTGAGGCTTCAATGATTAAGATGGGTAACATTGGTGTGCTCACTGGGAAGAAAGGAGAAATCAGAAAACATTGTAACTTTGTTAACAA
GAAATCTGTTGAAGTTGATATTGCTAGTGTGGCCTCAGAAGAATCATCAACAGAGGGTATGGTTACCTCAATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCTTTCCATCTCACAGTGACAGCTTTGTGCTGTGTAGTGGTTGTGCTTGGAGTGCTTCCACTCTCCCTAGATGCACAACTAGATCCCTCCTTTTACAGAGACACTTGTCCCAGG
GTTCACTCCATTGTTCGTGAAGTCGTCAGGAACGTTTCAAAGAAAGATCCCCGTATGCTTGCTAGTCTCATTAGACTTCACTTTCATGACTGCTTTGTTCAA
GGATGTGATGCATCAGTT
TTGTTGAACAACACTGCCACCATAGAGAGCGAGCAACAAGCTCTGCCAAACAACAACTCACTAAGAGGTTTGGATGTTGTGAACGACATTAAGACAGCAGTGGAAAAGGCTTGTCCCGGC
GTGGTTTCTTGTGCTGATATTCTTACCCTTGCATCCGAAATATCTTCTGTTCTG
GGTGGTGGTCCTGATTGGAAAGTTCCATTGGGAAGAAGAGATAGTTTAACAGCAAACCGAAACCTT
GCAAATCAAAACCTTCCAGCTCCATTCTTCAACCTATCTCGACTTAAATCTGCCTTTGCTGTTCAAGGTCTTGACACCACTGATCTAGTTGCACTCTCAG
GTGCTCATACATTCGGCAGA
GCTCACTGCAATTTCATTCTTGACCGATTGTACAATTTCAGTGGAACTGGCAAACCTGATCCAACTCTTGACACAACTTACTTACAACAATTGCGCCAAATATGCCCCAATGGTGGACCT
AACAACCTTGTCAATTTTGACCCTGTCACTCCTGATAAAATTGACAGGGTCTACTTCTCCAATCTTCAGGTTAAGAAGGGCTTGCTTCAGAGTGATCAAGAGCTGTTCTCGACACCTGGT
GCCGATACCATCCCCATTGTCAACAGGTTCAGCAGTGACCAGAAAGTTTTCTTTGACGCCTTTGAGGCTTCAATGATTAAGATGGGTAACATTGGTGTGCTCACTGGGAAGAAAGGAGAA
ATCAGAAAACATTGTAACTTTGTTAACAAGAAATCTGTTGAAGTTGATATTGCTAGTGTGGCCTCAGAAGAATCATCAACAGAGGGTATGGTTACCTCAATC

Retrieve as FASTA