Entry information : BfuNOx02 (NoxB)
Entry ID 6116
Creation 2008-02-21 (Christophe Dunand)
Last sequence changes 2012-04-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Christophe Dunand)
Peroxidase information: BfuNOx02 (NoxB)
Name (synonym) BfuNOx02 (NoxB)
Class Ancestral NADPH oxidase    [Orthogroup: NOx001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Botryotinia
Organism Botryotinia fuckeliana (Botrytis cinerea Sclerotinia fuckeliana)    [TaxId: 40559 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value BfuNOx02
start..stop
S start..stop
CgNOx02 977 0 14..581 21..583
NcNOx02 956 0 1..581 1..581
MgrNOx02 954 0 8..581 14..582
GzNOx02 928 0 9..581 1..570
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10802..10980 179 N° 2 11034..12565 1532 N° 3 12626..12660 35  
join(10802..10980,11034..12565,12626..12660)


exon

Literature and cross-references BfuNOx02 (NoxB)
Literature REFERENCE 1 Segmueller,N., Kokkelink,L., Giesbert,S. and Tudzynski,P. NADPH oxidases are involved in vegetative differentiation and pathogenicity in Botrytis cinerea.
REFERENCE 2 Silva,E.M., Valdes,J., Holmes,D., Shmaryahu,A. and Valenzuela,P.D. Generation and analysis of expressed sequence tags from Botrytis cinerea. Biol. Res. 39 (2), 367-379 (2006).
Protein ref. UniProtKB:   B0BES2 [Sequencing error]
DNA ref. GenBank:   AM900413 [Sequencing error] JGI genome:   Supercontig_1.153 (10802..11790) [5' end]
EST ref. GenBank:   EB803791 [3' end]
Protein sequence: BfuNOx02 (NoxB)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   581
PWM (Da):   %s   66284.2 Transmb domain:   %s   i60-82o97-119i140-162o177-199i220-242o252-274i419-441o
PI (pH):   %s   9.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSEKAYDRMSTGSVRVSERSRWPPLTRMLMSGEMTAEMPRELTMREKFDRWMVNEGYRRFFVFVFALLHVMVFTFGFLNYQLKDSFGIARSTFTVTYAIARSAALTLHFDVAMILFPVCRTLISLARQTPLNGIVQFDKNITFHMLTAWSIVFFSWVHTIAHWNNFAQISAKNNLGFGGFLLANFVSGPGWTGYVMLIALMAMAITSYEKYRRANFERFWYTHHFFVIFFVFWSVHGAFCMIQPDTAPYCVSVGTSAIGVFWQYWMYGGYIYLAERIAREIRGKHKTYVSKVVQHPSNVCEIQIKKENTKTRXXQYIFFCCPEVSIYQYPPFTLTSAPEEDYISIHIRMVGDFTRAVGKALGCEFDKPKDGKGGSQVVGVNQGSPGSDGADSAIRRILPRVYVDGPFGSASEDVFKFEVAMLCGAGIGVTPFASILKSIWYRMXYPQKKTRLGKVYFFWICRDFGSFEWFRSLLLAIEAQDMDNRIEIHTYLTAKIKVDDATNIMINDANADRDAITGLRAPTNFGRPNWDMIFKSVRKIHSPSEAGVFFCGPKVLGSQLHIKCNMYSEGFNFCWGKENF

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 1 EST. Strain="B05.10". Partial sequence from JGI (undetermined nt).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGAAAAGGCTTATGACAGAATGAGTACGGGGTCGGTGAGGGTTTCGGAGAGATCAAGATGGCCACCCTTGACAAGAATGTTGATGTCTGGTGAGATGACGGCGGAAATGCCGAGG
GAATTGACGATGAGGGAGAAATTCGACAGATGGATGGTTAACGAGGGATATCGACGATT
GTGGGTTATCACCAGAATCATGGGAAGCATCGAGTTACTAACATGCATTTCAGTTTCGTCT
TCGTTTTCGCTTTACTCCATGTCATGGTTTTCACATTCGGATTTTTGAATTATCAGCTCAAGGATAGTTTCGGTATTGCACGAAGTACATTTACCGTCACCTATGCGATTGCTAGATCCG
CTGCTTTGACGCTACATTTCGATGTGGCTATGATTTTGTTCCCGGTTTGTCGTACTTTGATCTCTTTGGCACGTCAAACTCCTTTGAACGGCATTGTACAATTCGATAAGAATATTACTT
TCCATATGCTCACAGCTTGGTCTATTGTATTCTTCTCTTGGGTACACACCATTGCGCATTGGAACAACTTTGCTCAAATTTCAGCAAAGAATAATCTCGGTTTTGGTGGTTTCCTCCTTG
CCAACTTTGTTAGTGGACCCGGATGGACTGGATATGTTATGTTGATCGCTCTCATGGCTATGGCTATTACTTCATACGAAAAGTATCGCCGGGCAAACTTCGAACGTTTCTGGTATACCC
ATCACTTTTTCGTCATCTTCTTTGTATTCTGGTCCGTCCACGGAGCTTTCTGTATGATTCAACCAGATACCGCACCTTACTGTGTCAGTGTTGGTACATCGGCTATTGGTGTCTTCTGGC
AATACTGGATGTATGGTGGTTACATTTACCTCGCTGAACGTATTGCACGTGAAATCCGCGGGAAGCATAAGACCTATGTTTCGAAAGTTGTTCAACACCCTTCCAACGTTTGCGAAATTC
AAATCAAGAAAGAGAATACAAAGACAAGASCCGSGCAATATATCTTTTTCTGTTGTCCCGAGGTCTCGATTTATCAATATCCTCCTTTCACTCTCACATCGGCCCCCGAAGAAGATTATA
TTTCTATTCACATCAGAATGGTAGGAGATTTTACTAGAGCTGTTGGAAAAGCCCTTGGATGTGAATTCGATAAGCCAAAGGATGGCAAGGGAGGATCTCAAGTTGTTGGTGTTAATCAAG
GCTCACCCGGATCTGATGGAGCTGATTCGGCTATTCGCCGCATCTTACCCCGTGTCTACGTTGACGGCCCATTCGGTTCCGCCTCTGAGGATGTTTTCAAATTCGAAGTCGCTATGCTTT
GTGGTGCCGGTATTGGTGTTACTCCCTTCGCCTCGATTCTTAAATCCATCTGGTACCGCATGARCTATCCTCAAAAGAAGACGCGTCTCGGAAAAGTTTATTTCTTCTGGATTTGTCGTG
ATTTCGGTTCTTTCGAATGGTTCCGTTCGCTTTTATTGGCAATCGAAGCTCAGGATATGGACAACAGGATTGAGATTCACACGTATTTGACGGCTAAGATTAAGGTGGATGATGCGACGA
ACATCATGATTAATGATGCCAATGCGGATCGTGATGCAATTACGGGTTTGAGAGCACCAACCAACTTTGGAAGACCTAATTGGGATATGATTTTCAAGAGTGTGAGAAAGATTCACAGTC
CCAGTGAAGCGGGTGTGTTCTTCTGTGGTCCAAAAGTGTTGGGTAGTCAGTTGCATATCAAGTGTAATATGTATAGTGAGCCTG
GTTAGTACTTTCCATTTATCTCCTTTTTAGCATTGA
TGCATTATACTAATACTAGAATAGGATTCAATTTCTGCTGGGGCAAAGAAAATTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGAAAAGGCTTATGACAGAATGAGTACGGGGTCGGTGAGGGTTTCGGAGAGATCAAGATGGCCACCCTTGACAAGAATGTTGATGTCTGGTGAGATGACGGCGGAAATGCCGAGG
GAATTGACGATGAGGGAGAAATTCGACAGATGGATGGTTAACGAGGGATATCGACGATT
TTTCGTCTTCGTTTTCGCTTTACTCCATGTCATGGTTTTCACATTCGGATTTTTGAATTAT
CAGCTCAAGGATAGTTTCGGTATTGCACGAAGTACATTTACCGTCACCTATGCGATTGCTAGATCCGCTGCTTTGACGCTACATTTCGATGTGGCTATGATTTTGTTCCCGGTTTGTCGT
ACTTTGATCTCTTTGGCACGTCAAACTCCTTTGAACGGCATTGTACAATTCGATAAGAATATTACTTTCCATATGCTCACAGCTTGGTCTATTGTATTCTTCTCTTGGGTACACACCATT
GCGCATTGGAACAACTTTGCTCAAATTTCAGCAAAGAATAATCTCGGTTTTGGTGGTTTCCTCCTTGCCAACTTTGTTAGTGGACCCGGATGGACTGGATATGTTATGTTGATCGCTCTC
ATGGCTATGGCTATTACTTCATACGAAAAGTATCGCCGGGCAAACTTCGAACGTTTCTGGTATACCCATCACTTTTTCGTCATCTTCTTTGTATTCTGGTCCGTCCACGGAGCTTTCTGT
ATGATTCAACCAGATACCGCACCTTACTGTGTCAGTGTTGGTACATCGGCTATTGGTGTCTTCTGGCAATACTGGATGTATGGTGGTTACATTTACCTCGCTGAACGTATTGCACGTGAA
ATCCGCGGGAAGCATAAGACCTATGTTTCGAAAGTTGTTCAACACCCTTCCAACGTTTGCGAAATTCAAATCAAGAAAGAGAATACAAAGACAAGASCCGSGCAATATATCTTTTTCTGT
TGTCCCGAGGTCTCGATTTATCAATATCCTCCTTTCACTCTCACATCGGCCCCCGAAGAAGATTATATTTCTATTCACATCAGAATGGTAGGAGATTTTACTAGAGCTGTTGGAAAAGCC
CTTGGATGTGAATTCGATAAGCCAAAGGATGGCAAGGGAGGATCTCAAGTTGTTGGTGTTAATCAAGGCTCACCCGGATCTGATGGAGCTGATTCGGCTATTCGCCGCATCTTACCCCGT
GTCTACGTTGACGGCCCATTCGGTTCCGCCTCTGAGGATGTTTTCAAATTCGAAGTCGCTATGCTTTGTGGTGCCGGTATTGGTGTTACTCCCTTCGCCTCGATTCTTAAATCCATCTGG
TACCGCATGARCTATCCTCAAAAGAAGACGCGTCTCGGAAAAGTTTATTTCTTCTGGATTTGTCGTGATTTCGGTTCTTTCGAATGGTTCCGTTCGCTTTTATTGGCAATCGAAGCTCAG
GATATGGACAACAGGATTGAGATTCACACGTATTTGACGGCTAAGATTAAGGTGGATGATGCGACGAACATCATGATTAATGATGCCAATGCGGATCGTGATGCAATTACGGGTTTGAGA
GCACCAACCAACTTTGGAAGACCTAATTGGGATATGATTTTCAAGAGTGTGAGAAAGATTCACAGTCCCAGTGAAGCGGGTGTGTTCTTCTGTGGTCCAAAAGTGTTGGGTAGTCAGTTG
CATATCAAGTGTAATATGTATAGTGAGCCTG
GATTCAATTTCTGCTGGGGCAAAGAAAATTTCTAA

Retrieve as FASTA