Entry information : ZmPrx114 (GRMZM2G450717)
Entry ID 6127
Creation 2008-05-02 (Christophe Dunand)
Last sequence changes 2011-01-25 (Christophe Dunand)
Sequence status complete
Reviewer Michele Oliva
Last annotation changes 2011-01-25 (Christophe Dunand)
Peroxidase information: ZmPrx114 (GRMZM2G450717)
Name (synonym) ZmPrx114 (GRMZM2G450717)
Class Class III peroxidase    [Orthogroup: Prx111]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx114
start..stop
S start..stop
ZmPrx07 495 8e-179 28..313 34..319
ZmPrx66 491 5e-177 28..313 34..319
ZmPrx42 485 1e-174 24..313 30..319
SbPrx47 461 2e-165 1..313 1..311
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 216821649..216821858 210 N° 2 216821924..216822109 186 N° 3 216822241..216822403 163 N° 4 216822492..216822877 386
join(216821649..216821858,216821924..216822109,216822241..216822403,216822492..2 16822877)


exon

Literature and cross-references ZmPrx114 (GRMZM2G450717)
Literature Collura,K., Wissotski,M., Campos,D., Kudrna,D., Golser,W., Ashely ,E., Haller,K., Wing,R., Soderlund,C., Walbot,V. and Yu,Y. Maize Full-length cDNA Project.
EST ref. GenBank:   EE160928 [5' end]
Protein sequence: ZmPrx114 (GRMZM2G450717)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (291)
PWM (Da):   %s   32630.06 (30475.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.16 (5.16) Peptide Signal:   %s   cut: 24 range:24-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASASCLLSLLVVVVLAALASAQLSSTFYDTSCPSALSTISSGVTAAVAQEARVGASLLRLHFHDCFVQGCDASVLLNDTSGEQNQIPNQTLNPRGFDVFDSIKAQVEAVCPGIVSCADILAVAARDGVVALGGPSWTVALGRRDSTASFPAQTSDLPPPTSSLQQLLRAYSKKNLNQTDMVALSGAHTIGQAQCLSFNDHIYNDTNINPAFAMSLRTNCPASGSSSLAPLDAMTPTAFDNAYYTNLLSQRGLLHSDQELFNNGSADSTVSSFAANAAAFTSAFATAMVKMGNLSPLTGSQGQVRINCWRVNG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns) and 1 EST. Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCTCTGCTTCTTGCCTGCTTAGCCTCTTGGTGGTGGTGGTGCTGGCGGCGCTGGCCTCGGCGCAGCTTTCGTCGACGTTCTACGACACGTCGTGCCCCAGCGCGCTGTCCACC
ATCAGCAGCGGCGTGACCGCGGCGGTGGCGCAGGAGGCTCGCGTGGGGGCGTCGCTGCTCAGGCTGCACTTCCACGACTGCTTTGTGCAG
GCAAGTAGCAGCTAAATTAACTAAGTAGAT
CGGAATTAATTTCTGACATCTATCATATCCAGCAGGGCTGCGACGCGTCCGTTCTGCTGAACGACACGTCCGGGGAGCAGAACCAGATTCCGAACCAGACTCTGAATCCTAGGGGCTTCG
ATGTCTTTGACAGCATCAAGGCGCAGGTGGAGGCGGTGTGCCCGGGGATCGTCTCCTGCGCCGACATCCTCGCCGTAGCCGCCAGGGACGGAGTGGTCGCG
GTGAGATATACTATCATTA
ATTAATTAGATATATGCTGTCATGATCAGCATGCTGTAGTGTAGCTAGCGTTAGTTAATTAGCCAGCAGCTAGCTGATGATGCTTTGCTGTGTTGGTTGGTTTAATTTCCAGCTCGGCGG
GCCTTCGTGGACAGTTGCACTGGGGAGAAGGGACTCCACTGCTTCGTTCCCGGCACAGACGAGCGACCTCCCGCCTCCTACGTCCAGCCTCCAGCAGCTTCTGCGCGCGTATAGCAAAAA
GAATCTCAACCAAACCGACATGGTTGCTCTCTCAG
GTGCCTCCGATCGATCATAGCTAGCAGCTATAGCTTATTAGCTACTGATCGACGATGACGATGACGATATATATGCATGCATATG
AAGGTGCTCACACGATCGGACAGGCGCAGTGCTTGAGCTTCAACGACCACATCTACAACGACACCAACATCAACCCCGCCTTCGCCATGTCGCTGAGGACCAACTGCCCCGCGTCCGGCA
GCAGCAGCCTGGCGCCTCTGGACGCCATGACGCCCACCGCTTTCGACAACGCCTACTACACCAACCTGCTGTCCCAGAGGGGCCTCCTGCACTCGGACCAGGAGCTCTTCAACAACGGCA
GCGCCGACAGCACGGTCAGCAGCTTCGCGGCCAACGCCGCAGCCTTCACCAGCGCTTTCGCCACGGCGATGGTGAAGATGGGGAACCTCAGCCCACTCACCGGGTCACAGGGGCAGGTCA
GGATCAATTGCTGGAGGGTCAACGGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCCTCTGCTTCTTGCCTGCTTAGCCTCTTGGTGGTGGTGGTGCTGGCGGCGCTGGCCTCGGCGCAGCTTTCGTCGACGTTCTACGACACGTCGTGCCCCAGCGCGCTGTCCACC
ATCAGCAGCGGCGTGACCGCGGCGGTGGCGCAGGAGGCTCGCGTGGGGGCGTCGCTGCTCAGGCTGCACTTCCACGACTGCTTTGTGCAG
GGCTGCGACGCGTCCGTTCTGCTGAACGAC
ACGTCCGGGGAGCAGAACCAGATTCCGAACCAGACTCTGAATCCTAGGGGCTTCGATGTCTTTGACAGCATCAAGGCGCAGGTGGAGGCGGTGTGCCCGGGGATCGTCTCCTGCGCCGAC
ATCCTCGCCGTAGCCGCCAGGGACGGAGTGGTCGCG
CTCGGCGGGCCTTCGTGGACAGTTGCACTGGGGAGAAGGGACTCCACTGCTTCGTTCCCGGCACAGACGAGCGACCTCCCGCCT
CCTACGTCCAGCCTCCAGCAGCTTCTGCGCGCGTATAGCAAAAAGAATCTCAACCAAACCGACATGGTTGCTCTCTCAG
GTGCTCACACGATCGGACAGGCGCAGTGCTTGAGCTTCAAC
GACCACATCTACAACGACACCAACATCAACCCCGCCTTCGCCATGTCGCTGAGGACCAACTGCCCCGCGTCCGGCAGCAGCAGCCTGGCGCCTCTGGACGCCATGACGCCCACCGCTTTC
GACAACGCCTACTACACCAACCTGCTGTCCCAGAGGGGCCTCCTGCACTCGGACCAGGAGCTCTTCAACAACGGCAGCGCCGACAGCACGGTCAGCAGCTTCGCGGCCAACGCCGCAGCC
TTCACCAGCGCTTTCGCCACGGCGATGGTGAAGATGGGGAACCTCAGCCCACTCACCGGGTCACAGGGGCAGGTCAGGATCAATTGCTGGAGGGTCAACGGCTAG

Retrieve as FASTA