Entry information : PtPrxIIC-2 (POPTR_0001s44990 / PtPrxIIC-2)
Entry ID 6128
Creation 2008-05-07 (Christophe Dunand)
Last sequence changes 2008-05-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrxIIC-2 (POPTR_0001s44990 / PtPrxIIC-2)
Name (synonym) PtPrxIIC-2 (POPTR_0001s44990 / PtPrxIIC-2)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrxIIC-2
start..stop
S start..stop
PtrtrPrxII02 328 6e-118 1..162 1..162
PtPrxII03 319 2e-114 1..162 1..162
PbPrxII03 319 2e-114 1..162 1..162
PtremPrxII03 317 2e-113 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45313045..45313199 155 N° 2 45312880..45312959 80 N° 3 45312521..45312774 254  
complement(join(45312521..45312774,45312880..45312959,45313045..45313199))


exon

Literature and cross-references PtPrxIIC-2 (POPTR_0001s44990 / PtPrxIIC-2)
Literature US DOE Joint Genome Institute (JGI-PGF).
DNA ref. Phytozome 11:   scaffold_1 (45313199..45312521)
Protein sequence: PtPrxIIC-2 (POPTR_0001s44990 / PtPrxIIC-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17292  
PI (pH):   %s   5.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDVLPDGKLAYFDEQDQLQDVSVHSLAAGKKVILFGVPGAFTPTCSLKHVPGFVEKAEELKSKGVAEILCIVNDPFVMKAWAKTYPENKHVKFLADGSATYTHALGLELDLQEKGLGTRSRRFALLVDDLKVKAANIEGGGEFTVSSADDILKDL

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATTGCTGTCGGTGATGTCTTGCCTGATGGAAAGCTCGCTTATTTCGACGAACAAGATCAGCTCCAGGACGTGTCTGTACACTCTCTTGCTGCCGGTAAAAAGGTCATCCTC
TTTGGTGTTCCCGGTGCCTTCACCCCCACTTGCAG
GTTTATTATTTGTAATTCAGTATTTAAGCATATATGATCTGGGGTTTTAGGTCTGGTTTTGATTTCGTTTTTTGGTGATGTGTAG

CTTGAAGCATGTGCCAGGGTTTGTTGAGAAAGCAGAGGAGCTTAAATCCAAGGGGGTTGCTGAAATTTTGTGCATCAGCG
GTATGTCCTCGTTTTCCTTTTTTCTTTTTCAATCCATGTC
TTCACCCCAACTCTCAACATCTAGTCTTGTTGTTAATTTTTGTTTTTATTATTATTCATTTCCAGTGAATGACCCCTTTGTGATGAAAGCATGGGCAAAAACTTACCCTGAGAATAAGCA
TGTCAAATTCCTAGCTGATGGATCTGCAACATACACCCATGCTCTTGGCCTTGAGCTTGACCTGCAAGAGAAGGGACTTGGCACCCGTTCTAGGAGGTTTGCTCTCTTGGTCGATGACCT
CAAGGTGAAAGCTGCAAATATTGAAGGTGGTGGAGAATTCACTGTGTCCAGTGCTGATGATATCCTCAAGGATCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCGATTGCTGTCGGTGATGTCTTGCCTGATGGAAAGCTCGCTTATTTCGACGAACAAGATCAGCTCCAGGACGTGTCTGTACACTCTCTTGCTGCCGGTAAAAAGGTCATCCTC
TTTGGTGTTCCCGGTGCCTTCACCCCCACTTGCAG
CTTGAAGCATGTGCCAGGGTTTGTTGAGAAAGCAGAGGAGCTTAAATCCAAGGGGGTTGCTGAAATTTTGTGCATCAGCGTGAAT
GACCCCTTTGTGATGAAAGCATGGGCAAAAACTTACCCTGAGAATAAGCATGTCAAATTCCTAGCTGATGGATCTGCAACATACACCCATGCTCTTGGCCTTGAGCTTGACCTGCAAGAG
AAGGGACTTGGCACCCGTTCTAGGAGGTTTGCTCTCTTGGTCGATGACCTCAAGGTGAAAGCTGCAAATATTGAAGGTGGTGGAGAATTCACTGTGTCCAGTGCTGATGATATCCTCAAG
GATCTTTAA

Retrieve as FASTA