Entry information : SmPrx10-1_3 (SmPrx10a_3)
Entry ID 6199
Creation 2008-06-26 (Christophe Dunand)
Last sequence changes 2008-06-26 (Christophe Dunand)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx10-1_3 (SmPrx10a_3)
Name (synonym) SmPrx10-1_3 (SmPrx10a_3)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx10-1_3
start..stop
S start..stop
SmPrx10-2_25 666 0 1..325 1..325
SmPrx35-1_84 383 5e-134 8..323 12..328
SmPrx35-2_170 382 6e-134 8..323 12..328
SmPrx70-1_38 369 2e-128 1..323 4..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1940391..1940597 207 N° 2 1940139..1940327 189 N° 3 1939910..1940075 166 N° 4 1939433..1939848 416
complement(join(1939433..1939848,1939910..1940075,1940139..1940327,1940391..1940 597))


exon

Literature and cross-references SmPrx10-1_3 (SmPrx10a_3)
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M. and Lindquist,E.A. DOE Joint Genome Institute Selaginella moellendorffii EST project. Unpublished (2008)
DNA ref. Phytozome 12:   scaffold_3 (1940597..1939433)
mRNA ref. JGI transcript:   266691
EST ref. GenBank:   FE490376.1 [5' end]   FE490375.1 [3' end]
Protein sequence: SmPrx10-1_3 (SmPrx10a_3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (304)
PWM (Da):   %s   34562.53 (32434.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.99 (7.72) Peptide Signal:   %s   cut: 22 range:22-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLWIAVVFGTIGILASVASSQLSVGFYEKQCPQVEAVVQSFVQDAITRKPGVGAGLLRLQFHDCFVQGCDASVLIDSTKNNSAEKDAPPNISLRGFEVIDAAKAALETQCPGVVSCADIVAYAARDSVFKLGGPFWEVPVGRRDGTISRMKEANASLPAPFFNVAQLTQNFAAQGLSQDDMIVLSGAHTIGIAHCFTFSPRLYNFSANASTDPTLDPNFATALKKQCPPGKAAAFNSVVLDSHTPIHFDNSYYVNLALQKGVLGSDQVLFSDAATSKAIKTSSVDEESWRAKFAAAMIKMGSVKVKTGQQGEIRKSCRAVNHS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGCTCTGGATTGCAGTGGTCTTTGGAACGATCGGGATCCTCGCAAGCGTTGCTAGCTCGCAGCTGAGCGTGGGATTTTACGAGAAGCAATGCCCGCAAGTGGAAGCGGTGGTC
CAGAGCTTCGTCCAGGATGCCATCACCAGGAAGCCGGGAGTTGGAGCTGGGCTGCTTCGCCTACAGTTCCACGACTGCTTTGTCCAA
GTAAGATTTCTCTCTATGTTTTTGTCTACTAAA
AGTTTCATGCTGTTCTTCTTTTGATTCCAGGGGTGTGACGCTTCCGTGCTTATAGATTCCACCAAGAACAATTCTGCCGAGAAGGACGCTCCACCCAACATAAGCTTGAGGGGATTCGAG
GTGATCGACGCAGCCAAAGCAGCGTTGGAGACGCAGTGCCCGGGAGTGGTGTCCTGCGCAGACATCGTGGCGTACGCTGCTCGAGACAGCGTCTTCAAG
GCACTGTTCTTTCCTCATCTT
TTCCAGATCAAACTCACATCTTGTTTTTCGTTTCTTTCTCAGCTTGGAGGGCCGTTCTGGGAGGTGCCGGTCGGGAGAAGAGACGGGACGATCTCGCGAATGAAGGAGGCAAATGCGAGC
CTGCCAGCTCCGTTCTTCAACGTGGCGCAGCTCACCCAGAACTTCGCAGCGCAGGGCCTCTCTCAAGACGACATGATCGTTCTCTCGG
GTAAAAATCAAATTTTTAAACTCTCTAGCCGC
GCTAAAGAAAAAAAAACTTTGACCTTCAGGAGCTCACACGATCGGGATCGCGCACTGCTTCACATTCAGCCCCAGGCTGTACAACTTCAGCGCCAACGCTTCCACGGATCCCACCCTGGA
TCCAAACTTCGCGACCGCCTTGAAGAAGCAGTGCCCGCCAGGGAAAGCCGCGGCATTCAACTCGGTGGTGCTCGACTCCCACACTCCCATCCACTTCGACAACAGCTACTACGTGAATCT
GGCGCTGCAAAAGGGCGTGCTGGGGTCGGACCAGGTGCTCTTCTCGGACGCGGCCACCAGCAAGGCCATCAAGACGAGCTCCGTGGACGAGGAGAGCTGGCGGGCCAAGTTCGCGGCGGC
CATGATCAAGATGGGCAGCGTCAAGGTGAAGACGGGGCAGCAGGGCGAGATCCGCAAGAGCTGCCGAGCGGTCAATCACTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGCTCTGGATTGCAGTGGTCTTTGGAACGATCGGGATCCTCGCAAGCGTTGCTAGCTCGCAGCTGAGCGTGGGATTTTACGAGAAGCAATGCCCGCAAGTGGAAGCGGTGGTC
CAGAGCTTCGTCCAGGATGCCATCACCAGGAAGCCGGGAGTTGGAGCTGGGCTGCTTCGCCTACAGTTCCACGACTGCTTTGTCCAA
GGGTGTGACGCTTCCGTGCTTATAGATTCCACC
AAGAACAATTCTGCCGAGAAGGACGCTCCACCCAACATAAGCTTGAGGGGATTCGAGGTGATCGACGCAGCCAAAGCAGCGTTGGAGACGCAGTGCCCGGGAGTGGTGTCCTGCGCAGAC
ATCGTGGCGTACGCTGCTCGAGACAGCGTCTTCAAG
CTTGGAGGGCCGTTCTGGGAGGTGCCGGTCGGGAGAAGAGACGGGACGATCTCGCGAATGAAGGAGGCAAATGCGAGCCTGCCA
GCTCCGTTCTTCAACGTGGCGCAGCTCACCCAGAACTTCGCAGCGCAGGGCCTCTCTCAAGACGACATGATCGTTCTCTCGG
GAGCTCACACGATCGGGATCGCGCACTGCTTCACATTC
AGCCCCAGGCTGTACAACTTCAGCGCCAACGCTTCCACGGATCCCACCCTGGATCCAAACTTCGCGACCGCCTTGAAGAAGCAGTGCCCGCCAGGGAAAGCCGCGGCATTCAACTCGGTG
GTGCTCGACTCCCACACTCCCATCCACTTCGACAACAGCTACTACGTGAATCTGGCGCTGCAAAAGGGCGTGCTGGGGTCGGACCAGGTGCTCTTCTCGGACGCGGCCACCAGCAAGGCC
ATCAAGACGAGCTCCGTGGACGAGGAGAGCTGGCGGGCCAAGTTCGCGGCGGCCATGATCAAGATGGGCAGCGTCAAGGTGAAGACGGGGCAGCAGGGCGAGATCCGCAAGAGCTGCCGA
GCGGTCAATCACTCGTGA

Retrieve as FASTA