Entry information : SmPrx54-1_5 (SmPrx54a_5)
Entry ID 6207
Creation 2008-07-01 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx54-1_5 (SmPrx54a_5)
Name (synonym) SmPrx54-1_5 (SmPrx54a_5)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx54-1_5
start..stop
S start..stop
SmPrx54-2_1 662 0 1..331 1..331
PabPrx86 381 3e-133 28..330 24..327
SmPrx59-1_19 381 3e-133 29..330 31..332
SmPrx59-2_61 378 4e-132 29..330 32..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 856996..857217 222 N° 2 856727..856921 195 N° 3 856507..856672 166 N° 4 855804..856216 413
complement(join(855804..856216,856507..856672,856727..856921,856996..857217))


exon

Literature and cross-references SmPrx54-1_5 (SmPrx54a_5)
Literature JGI
DNA ref. Phytozome 11:   scaffold_5 (857217..855804)
mRNA ref. JGI transcript:   230472
Protein sequence: SmPrx54-1_5 (SmPrx54a_5)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331
PWM (Da):   %s   35088.98 Transmb domain:   %s   i7-26o
PI (pH):   %s   7.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRSSALLSIFLAVAPVLIVAEIAIFPRLATDFYVRSCPELPSIVRRVIAAKFAQTPVAAAGMLRIFFHDCMVEGCDASVLVASTPSNKAEKDAEINLSLPGDGFDAVIKAKAAVESKCPGVVSCADILALSTRELVVLIGGPSWEVRLGRRDGTVSKASRVPGNLPMPNMTVAELTSLFASKGLSLQDMVALTGGGHTAGFAHCNQFMDRIYGTIDPTMNPSYAAELRQACPRGPTLDPTVVTHLDPSTPDLFDNAFFKNTLYGRGLLRSDQALFSTSNSSARPLVNLFAGSQPRFFEAFGVAMDKLGGIGVKTGGQGEIRRDCAAFNHA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGGAGCAGTGCACTGCTTTCAATCTTCCTCGCAGTTGCTCCGGTGCTCATCGTCGCCGAGATCGCGATTTTCCCTCGCCTCGCCACTGACTTCTACGTGAGATCCTGCCCGGAG
CTCCCTAGCATCGTGCGGCGCGTCATTGCGGCCAAGTTTGCGCAGACGCCAGTGGCCGCTGCTGGGATGCTGCGGATCTTCTTCCACGATTGCATGGTTGAG
GTAAAACAGCCTTGCGGA
TCGTTCCTGTTCTTGGCTTGGCGCATTCTAAAAGTTTAACTTTGTTTCTTCGAAAGGGGTGTGATGCCTCAGTGCTAGTCGCGTCCACTCCGAGCAACAAGGCTGAGAAGGATGCCGAGA
TCAATCTCTCCTTGCCTGGAGATGGATTTGACGCGGTGATCAAGGCCAAGGCCGCGGTGGAATCAAAGTGTCCCGGCGTTGTCTCCTGTGCTGACATTCTTGCTTTGAGCACCCGAGAGC
TCGTCGTCCTG
GTAAGAAACTGAGAGACAACATCTTAACGTTTGCAAAGCTTCCGTTTTCTACAGATTGGAGGGCCCTCTTGGGAAGTTCGTCTTGGTCGGAGAGATGGCACGGTCTCGA
AAGCTTCCAGAGTTCCTGGAAATCTCCCCATGCCAAACATGACAGTGGCAGAGCTAACTTCGCTCTTCGCCTCCAAAGGCCTCTCTCTCCAGGACATGGTGGCGCTCACCG
GTATGAACT
CCTTCCCTTTCACTCCAATCCTATACCTGATCTCATACGCTCAAGACAGTTCAAAGCTTCTCAGAGCATTTGCCTTCGTTTTTACTTTCCAAGCATTTTTTCCTCGCACCGTGCTAGTCA
ATCGAGAGATCATTCACGCTTGGGTTAGCATCCATACATCCCGGAACAATAAAACCATTCCCACGATCTTACATGACATAAATTCTTTCTCTACATTCTTGTACTGCTGACACCCGCAGT
CCTCGATCGATCGATCGCTGGATGCATTTATTCCATCCCAGGAGGAGGCCACACCGCTGGATTCGCGCACTGCAACCAATTCATGGACCGCATTTATGGAACCATCGATCCCACCATGAA
TCCCTCCTACGCTGCCGAGCTCCGCCAGGCGTGCCCGAGGGGCCCGACTCTGGATCCAACCGTGGTCACGCACCTCGACCCCTCCACCCCCGACCTCTTCGACAACGCCTTCTTCAAGAA
CACACTGTACGGGCGAGGATTGCTGCGCTCCGACCAGGCCCTCTTCTCCACCTCCAACTCTTCCGCGAGGCCGCTCGTCAATCTCTTTGCTGGATCGCAGCCGCGATTCTTCGAGGCGTT
CGGCGTCGCCATGGACAAGCTCGGCGGCATTGGCGTCAAGACGGGAGGACAGGGAGAGATCCGCCGGGATTGCGCTGCCTTCAACCATGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGGAGCAGTGCACTGCTTTCAATCTTCCTCGCAGTTGCTCCGGTGCTCATCGTCGCCGAGATCGCGATTTTCCCTCGCCTCGCCACTGACTTCTACGTGAGATCCTGCCCGGAG
CTCCCTAGCATCGTGCGGCGCGTCATTGCGGCCAAGTTTGCGCAGACGCCAGTGGCCGCTGCTGGGATGCTGCGGATCTTCTTCCACGATTGCATGGTTGAG
GGGTGTGATGCCTCAGTG
CTAGTCGCGTCCACTCCGAGCAACAAGGCTGAGAAGGATGCCGAGATCAATCTCTCCTTGCCTGGAGATGGATTTGACGCGGTGATCAAGGCCAAGGCCGCGGTGGAATCAAAGTGTCCC
GGCGTTGTCTCCTGTGCTGACATTCTTGCTTTGAGCACCCGAGAGCTCGTCGTCCTG
ATTGGAGGGCCCTCTTGGGAAGTTCGTCTTGGTCGGAGAGATGGCACGGTCTCGAAAGCTTCC
AGAGTTCCTGGAAATCTCCCCATGCCAAACATGACAGTGGCAGAGCTAACTTCGCTCTTCGCCTCCAAAGGCCTCTCTCTCCAGGACATGGTGGCGCTCACCG
GAGGAGGCCACACCGCT
GGATTCGCGCACTGCAACCAATTCATGGACCGCATTTATGGAACCATCGATCCCACCATGAATCCCTCCTACGCTGCCGAGCTCCGCCAGGCGTGCCCGAGGGGCCCGACTCTGGATCCA
ACCGTGGTCACGCACCTCGACCCCTCCACCCCCGACCTCTTCGACAACGCCTTCTTCAAGAACACACTGTACGGGCGAGGATTGCTGCGCTCCGACCAGGCCCTCTTCTCCACCTCCAAC
TCTTCCGCGAGGCCGCTCGTCAATCTCTTTGCTGGATCGCAGCCGCGATTCTTCGAGGCGTTCGGCGTCGCCATGGACAAGCTCGGCGGCATTGGCGTCAAGACGGGAGGACAGGGAGAG
ATCCGCCGGGATTGCGCTGCCTTCAACCATGCCTGA

Retrieve as FASTA