Entry information : SmDiOx-2_8 (SmDiOxb_8)
Entry ID 6213
Creation 2010-03-03 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmDiOx-2_8 (SmDiOxb_8)
Name (synonym) SmDiOx-2_8 (SmDiOxb_8)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmDiOx-2_8
start..stop
S start..stop
SmDiOx-1_0 1155 0 1..571 1..574
PabDiOx01 702 0 42..571 97..623
CclDiOx02 689 0 7..571 62..623
HaDiOx06 685 0 48..571 107..627
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2173417..2173533 117 N° 2 2173248..2173340 93 N° 3 2173023..2173181 159 N° 4 2172828..2172961 134
N° 5 2172579..2172781 203 N° 6 2172359..2172504 146 N° 7 2172057..2172293 237 N° 8 2171791..2171993 203
N° 9 2171476..2171719 244 N° 10 2171242..2171419 178  
complement(join(2171242..2171419,2171476..2171719,2171791..2171993,2172057..2172 293,2172359..2172504,2172579..2172781,2172828..2172961,2173023..2173181,2173248. .2173340,2173417..2173533))


exon

Literature and cross-references SmDiOx-2_8 (SmDiOxb_8)
DNA ref. Phytozome 12:   scaffold_8 (2173533..2171242)
Protein sequence: SmDiOx-2_8 (SmDiOxb_8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   571
PWM (Da):   %s   63903.74  
PI (pH):   %s   7.1
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISDRPFRRQTHGVAQAPACVLAVLSRHPEDTPPKLQLEKKSGGEHVNVKSGDYGSFIGRNAFAAASGSEELLDPHPSVVATKFLARKESEFADTGKQFNMIAASWIQFMIHDWVDHQEDTKEQEIVAPESVAAQCPLKEFRFLRTKEDETGSQDIALGHRNMRTSWWDGSVLYGSHDGALXRGCDGKLKIGQNGLLERDDHGVAISGDVKNTWAGVSILQALFVKEHNAVCDMLKRTHPEFGDEELYLHARLVVAAVIAKIHTIDWTVELLKTKALDIGMHANWYGLLGKRIKSWIGHTGSSLLSGFIGMKEPINHGVPYALTEEFTCVYRLHPLLPDDIVLRDITGSAEEKQTKTPRATGKRIPMIELIGSEGEKTLGSIGNERMIASLGHQACGALVLFNYPQWMRDLPQTGTDGINRPNHVDMAALEIYRDRERKVARYNAFRRNMLMIPIKKWEDLTDDKQTLALLREIYGEDVEKLDLLVGLLAEKKIKGFAISETSFFIFLLMATRRLEADRFFTSNFNAKSYTKEGLAWVNNTESLKDVLQRHHGNLVDKWLNARSAFSVWSA

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from JGI. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATATCAGATCGTCCATTTCGTCGACAAACACACGGCGTGGCACAAGCTCCCGCTTGTGTTCTCGCTGTTTTATCTCGACATCCGGAGGACACTCCACCAAAACTACAACTTGAAGTACG
TCGGTCCTCCAATCTCAGAAGAAGAGAAAAAAGCCGCGCAGGATGATTGCATAGCTCCGCCTTTCCGGAAGAAAAAATCCGGTGGCGAGCACGTCAATGTCAAAAGTGGAGACTATGGAT
CATTCATTGGGAGAAATGCCTTTGCTGCAGCATCCGGATCCGAGGT
CTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCATTCATGAGATTCGATTTGCGTCGAGCAGGAACTTTTGG
ATCCACATCCCAGTGTTGTGGCGACCAAATTTCTGGCGAGAAAGGAATCCGAATTCGCGGACACGGGCAAGCAGTTCAACATGATCGCGGCGTCCTGGATCCAGTTTATGATCCACGACT
GGGTCGACCACCAGGAAGACACAAAAGAGGT
ATGATTCGTGTGATCGAAGCCAAGGATTCTTCTCACGGATGATTTTGTTTTCGATCCAGCAAGAGATTGTAGCTCCGGAATCAGTCGCA
GCGCAGTGTCCCTTGAAGGAATTTCGGTTCCTCCGCACGAAAGAGGACGAAACGGGCTCGCAAGACATCGCTTTGGGCCATAGGAACATGAGAACATCGTGGTGGT
ACGAAACTCTTGTA
ATTGGAGGGAAGTTTCATTTTACATTCTAGGGATGGGAGTGTTCTATACGGGAGCCACGACGGTGCGCTGGNNCGAGGGTGCGATGGCAAACTTAAGATTGGCCAAAATGGCCTCCTTGA
GCGCGACGACCACGGCGTCGCCATCTCCGGCGATGTCAAGAACACCTGGGCCGGGGTTTCGATTCTCCAGGCGCTTTTCGTCAAGGAACACAATGCCGTGTGTGACATGCTCAAG
GTGCG
TGTGTCTCGATCGATCTCGAGCTCTGGATTGCCGCTAACTCGTGGCTATTCTCCGATATTTCGTTCCAGAGGACGCATCCGGAATTCGGGGACGAAGAGCTCTACCTTCATGCGAGATTG
GTGGTCGCTGCCGTGATTGCCAAGATTCACACCATCGACTGGACTGTGGAGCTGCTCAAGACGAAAGCGCTCGACATTGGAATGCATGCAAACTG
GTGAGCTTTTCTTCTTCACTTCCAT
CTTCTCCAGCGATTTCGACTGACTTCGAGAGTGCATCCAGGTATGGTTTACTGGGGAAGAGAATCAAGAGCTGGATCGGGCACACTGGATCCTCGCTGCTGAGTGGATTTATTGGAATGA
AGGAGCCAATAAACCACGGCGTTCCGTACGCCTTGACGGAGGAGTTTACGTGCGTTTATCGCCTCCATCCTTTGCTACCAGACGACATTGTGCTGAGAGACATCACTGGCAGTGCGGAAG
AGAAACAAACAAAGACTCCTCGAGCCACTGGAAAGAG
GTACCTCCATCTCTTTTTTTTTCTTTTACCACTCCTGACTAAACTTTTTCTTGTGCTCTATAGAATTCCCATGATCGAGCTCA
TTGGAAGTGAGGGAGAAAAAACGCTGGGTAGCATTGGAAACGAGAGAATGATCGCGTCGCTTGGGCATCAAGCTTGTGGGGCGCTCGTTCTTTTCAACTATCCGCAGTGGATGAGGGACC
TTCCCCAGACTGGAACCGACGGCATAAACCGGCCGAATCACGTCGACATGGCCGCCCTCGAGA
GTAAGTTCTGTTCTTGCCAGACGCTTGTTGTCCTCGATCTTATCTTTGCTTCTCTGT
AATTTTTGTCCCAGTTTACCGTGATCGCGAAAGAAAAGTTGCAAGATACAATGCCTTTCGGAGAAACATGTTGATGATTCCAATCAAGAAGTGGGAGGATCTCACCGATGACAAACAAAC
ACTCGCCTTGCTGAGGGAGATATACGGCGAGGACGTGGAGAAGCTCGACTTGCTCGTCGGCTTGCTGGCGGAGAAGAAGATCAAAGGCTTCGCCATTAGCGAGACGTCGTTTTTCATCTT
TCTCCTCATGGCCACCAG
GTAAAAACTGCTAGAACCAAGTCACAGTTTTAACACATTGCATTGCTTTCCCACAGGAGGCTAGAAGCTGATCGATTCTTTACCTCAAACTTTAACGCCAAG
AGCTACACCAAGGAGGGACTGGCGTGGGTGAACAACACCGAGAGCCTCAAAGACGTCCTCCAGAGGCACCACGGCAACTTGGTTGATAAGTGGCTAAACGCACGCAGCGCATTCAGCGTG
TGGAGTGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATATCAGATCGTCCATTTCGTCGACAAACACACGGCGTGGCACAAGCTCCCGCTTGTGTTCTCGCTGTTTTATCTCGACATCCGGAGGACACTCCACCAAAACTACAACTTGAAGTAAA
ATCCGGTGGCGAGCACGTCAATGTCAAAAGTGGAGACTATGGATCATTCATTGGGAGAAATGCCTTTGCTGCAGCATCCGGATCCGAGGT
ACTTTTGGATCCACATCCCAGTGTTGTGGC
GACCAAATTTCTGGCGAGAAAGGAATCCGAATTCGCGGACACGGGCAAGCAGTTCAACATGATCGCGGCGTCCTGGATCCAGTTTATGATCCACGACTGGGTCGACCACCAGGAAGACAC
AAAAGAGGT
AGAGATTGTAGCTCCGGAATCAGTCGCAGCGCAGTGTCCCTTGAAGGAATTTCGGTTCCTCCGCACGAAAGAGGACGAAACGGGCTCGCAAGACATCGCTTTGGGCCATAG
GAACATGAGAACATCGTGGTGGT
ATGGGAGTGTTCTATACGGGAGCCACGACGGTGCGCTGGNNCGAGGGTGCGATGGCAAACTTAAGATTGGCCAAAATGGCCTCCTTGAGCGCGACGA
CCACGGCGTCGCCATCTCCGGCGATGTCAAGAACACCTGGGCCGGGGTTTCGATTCTCCAGGCGCTTTTCGTCAAGGAACACAATGCCGTGTGTGACATGCTCAAG
AGGACGCATCCGGA
ATTCGGGGACGAAGAGCTCTACCTTCATGCGAGATTGGTGGTCGCTGCCGTGATTGCCAAGATTCACACCATCGACTGGACTGTGGAGCTGCTCAAGACGAAAGCGCTCGACATTGGAAT
GCATGCAAACTG
GTATGGTTTACTGGGGAAGAGAATCAAGAGCTGGATCGGGCACACTGGATCCTCGCTGCTGAGTGGATTTATTGGAATGAAGGAGCCAATAAACCACGGCGTTCCGTA
CGCCTTGACGGAGGAGTTTACGTGCGTTTATCGCCTCCATCCTTTGCTACCAGACGACATTGTGCTGAGAGACATCACTGGCAGTGCGGAAGAGAAACAAACAAAGACTCCTCGAGCCAC
TGGAAAGAG
AATTCCCATGATCGAGCTCATTGGAAGTGAGGGAGAAAAAACGCTGGGTAGCATTGGAAACGAGAGAATGATCGCGTCGCTTGGGCATCAAGCTTGTGGGGCGCTCGTTCT
TTTCAACTATCCGCAGTGGATGAGGGACCTTCCCCAGACTGGAACCGACGGCATAAACCGGCCGAATCACGTCGACATGGCCGCCCTCGAGA
TTTACCGTGATCGCGAAAGAAAAGTTGC
AAGATACAATGCCTTTCGGAGAAACATGTTGATGATTCCAATCAAGAAGTGGGAGGATCTCACCGATGACAAACAAACACTCGCCTTGCTGAGGGAGATATACGGCGAGGACGTGGAGAA
GCTCGACTTGCTCGTCGGCTTGCTGGCGGAGAAGAAGATCAAAGGCTTCGCCATTAGCGAGACGTCGTTTTTCATCTTTCTCCTCATGGCCACCAG
GAGGCTAGAAGCTGATCGATTCTT
TACCTCAAACTTTAACGCCAAGAGCTACACCAAGGAGGGACTGGCGTGGGTGAACAACACCGAGAGCCTCAAAGACGTCCTCCAGAGGCACCACGGCAACTTGGTTGATAAGTGGCTAAA
CGCACGCAGCGCATTCAGCGTGTGGAGTGCGTGA

Retrieve as FASTA