Entry information : Lbi2CysPrx (LbPrx2-Cys)
Entry ID 6230
Creation 2008-07-08 (Christophe Dunand)
Last sequence changes 2008-07-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: Lbi2CysPrx (LbPrx2-Cys)
Name (synonym) Lbi2CysPrx (LbPrx2-Cys)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Lbi2CysPrx
start..stop
S start..stop
Ccin2CysPrx 355 7e-127 1..219 1..211
Athi2CysPrx01 352 2e-125 1..219 1..217
Ab2CysPrx_bisporus 341 3e-121 1..219 1..214
Ppl2CysPrx01-1B 335 5e-119 1..219 1..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 964352..964452 101 N° 2 964511..964534 24 N° 3 964592..964615 24 N° 4 964668..964729 62
N° 5 964786..964984 199 N° 6 965044..965122 79 N° 7 965183..965353 171  
join(964352..964452,964511..964534,964592..964615,964668..964729,964786..964984, 965044..965122,965183..965353)


exon

Literature and cross-references Lbi2CysPrx (LbPrx2-Cys)
Literature Martin et al., The genome of Laccaria bicolor provides insights into mycorrhizal symbiosis. Nature 452 (7183), 88-92 (2008).
DOE Joint Genome Institute Laccaria bicolor EST project.
DNA ref. JGI genome:   LG_7 (964352..965353)
mRNA ref. GenBank:   XM_001883212
EST ref. GenBank:   EX788547 [5' end]
Cluster/Prediction ref. Genebank:   6078963
Protein sequence: Lbi2CysPrx (LbPrx2-Cys)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219
PWM (Da):   %s   24023.49  
PI (pH):   %s   5.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVALVQRPAPAFKAEAVAKGTFLDISSSDFLGQWVVLLFYPMDFTFVCPTEILAFNDALPRFKELNTTVGVSTDSKFSHLAWANQPRKEGGLGPDLKLPLLADRSMRISRDYGVLLEDEGIALRGLFIIDPKGILRQITVNDLPVGRSVEETIRLIQAFQFDAYGEVCPANWTEGSKTIKADPVAKLEYFTAVTDGQSNNHVNGEANGSVKKRARVD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 3 ESTs. Strain="S238N-H82".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCCCTCGTTCAGCGCCCAGCGCCCGCTTTCAAGGCTGAAGCAGTCGCTAAAGGCACCTTCTTGGACATTTCTTCGAGTGACTTCCTTGGCCAGTGGTGTGTCTTTTCATAAAGT
TCTCAACTGTTTATTCACTGATGTCGCCGTTGTTTAAAGGGTTGTCCTCCTATTCTATCCTATGTGAGTATAGGAAACTTTTTTTGTCGAGTTTCTTTCACCGACCTTATTCGCCACCAG

GGACTTCACCTTCGTCTGCCCTAC
GTGAGTACATAATGGCTTCCCTACATACCACTGACATATAAGTCTTGTTCAGGGAGATCCTTGCGTTCAACGACGCCTTGCCCCGCTTCAAAGAGC
TGAATACAACGGTCTTCG
GTGCGCCCCACTGAATCCTACCTTACCTGGAATTTACTGACTGGTATGCCACGAAGGCGTTTCAACCGACTCCAAGTTCTCCCACTTGGCGTGGGCTAACCA
GCCACGCAAAGAAGGTGGTCTTGGTCCTGATTTGAAGCTTCCCCTCTTGGCGGACAGGTCCATGCGAATCTCCCGTGACTACGGCGTACTTCTTGAGGACGAGGGTATTGCTCTGCGTGG
CCTATTCATTATTGATCCCAAGGGTATTCTGAG
GTGGGCTCTTTTTGTTGCACTCACCTGACAATGTTGCTAACGCCCCATGTCACATCAAGGCAAATCACTGTCAATGACCTTCCTGTA
GGCCGTTCGGTCGAAGAAACCATTCGTCTAATTCAAGCCTTCCAATTCACG
GTGCGGATCGGTTGTTCTTACCAAAAGGAGGTCATGCGGCTCATTTTTAAACACATTCAGGACGCCTAT
GGCGAGGTTTGCCCCGCGAACTGGACTGAAGGTTCCAAGACCATCAAAGCTGACCCTGTTGCCAAATTAGAATACTTCACTGCCGTGACCGATGGTCAGTCCAATAACCATGTTAATGGT
GAGGCGAATGGCTCTGTCAAGAAGCGCGCCCGCGTCGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCCCTCGTTCAGCGCCCAGCGCCCGCTTTCAAGGCTGAAGCAGTCGCTAAAGGCACCTTCTTGGACATTTCTTCGAGTGACTTCCTTGGCCAGTGGGTTGTCCTCCTATTCTAT
CCTAT
GGACTTCACCTTCGTCTGCCCTACGGAGATCCTTGCGTTCAACGACGCCTTGCCCCGCTTCAAAGAGCTGAATACAACGGTCTTCGGCGTTTCAACCGACTCCAAGTTCTCCCAC
TTGGCGTGGGCTAACCAGCCACGCAAAGAAGGTGGTCTTGGTCCTGATTTGAAGCTTCCCCTCTTGGCGGACAGGTCCATGCGAATCTCCCGTGACTACGGCGTACTTCTTGAGGACGAG
GGTATTGCTCTGCGTGGCCTATTCATTATTGATCCCAAGGGTATTCTGAG
GCAAATCACTGTCAATGACCTTCCTGTAGGCCGTTCGGTCGAAGAAACCATTCGTCTAATTCAAGCCTTC
CAATTCACG
GACGCCTATGGCGAGGTTTGCCCCGCGAACTGGACTGAAGGTTCCAAGACCATCAAAGCTGACCCTGTTGCCAAATTAGAATACTTCACTGCCGTGACCGATGGTCAGTCC
AATAACCATGTTAATGGTGAGGCGAATGGCTCTGTCAAGAAGCGCGCCCGCGTCGACTGA

Retrieve as FASTA