Entry information : MbrAPx01
Entry ID 6306
Creation 2008-08-04 (Christophe Dunand)
Last sequence changes 2012-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-07 (Christophe Dunand)
Peroxidase information: MbrAPx01
Name MbrAPx01
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Codonosigidae Monosiga
Organism Monosiga brevicollis    [TaxId: 81824 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MbrAPx01
start..stop
S start..stop
SAspAPx01 331 3e-114 9..287 61..338
OtAPx01 323 2e-105 10..282 30..313
OmarAPx01 303 2e-103 15..287 20..311
MpuAPx01 301 2e-102 4..281 29..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..139 139 N° 2 266..340 75 N° 3 461..678 218 N° 4 750..827 78
N° 5 909..1017 109 N° 6 1167..1222 56 N° 7 1384..1572 189  
join(1..139,266..340,461..678,750..827,909..1017,1167..1222,1384..1572)


exon

Literature and cross-references MbrAPx01
Literature King,N., et al., The genome of the choanoflagellate Monosiga brevicollis and the origin of metazoans. Nature 451 (7180), 783-788 (2008)
DNA ref. GenBank:   NW_001865039.1 (2082312..2083883) JGI genome:   scaffold_2 (2082312..2083883)
mRNA ref. GenBank:   XM_001742247
Cluster/Prediction ref. JGI gene:   13407
Protein sequence: MbrAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287
PWM (Da):   %s   31484.65  
PI (pH):   %s   7.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSHNSIGRRNQLKALKVDLAAFINEKNCHPILLRLAWHDAGTFDRHAPSDRCGGANGSIRLQEEMGHGANAGLSKGITFLRPFVEKHSPVSWADAIQMAGALAVELAGGPKLAMRYGRVDVEAAAVDGNLPDAMASNPAQHLRVFERMGFNDRDIVALSGAHTIGRAFKGRSGVTNNGYGDEAATRYTKSSAVARADGRAGVGMPGGRSWTPNWLTFDNSYFISLRQPREELLWMATDQALHEDPRFRPHFEEFARDQDAFFHAYAQAHKRLSELGSNFLFDITV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). No EST. Strain="SAW760"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCACAACTCAATTGGTCGTCGGAATCAGCTGAAAGCGCTCAAAGTAGATCTTGCCGCCTTTATTAACGAGAAGAACTGCCACCCCATCCTCCTTCGCCTTGCCTGGCACGATGCT
GGTACCTTTGATCGCCACG
GTGAGTTGGAGTGAATGCATGGTCCCCAGTTACTTTATCCGCTGACCGCCACTGACCCGACGCCTTTCTCGTTTGATTGACGCCCTCTTGGCTTGACCGAC
CCGTTTGTGCCACGACTCATCGCAGCCCCATCGGACCGCTGTGGGGGCGCCAATGGCAGCATTCGCCTTCAGGAGGAGATGGGGCATGGCGCCAACGCCGGTGGGTCCCCACGCCCTGAA
CCCACCAACCCCCCAAGCGCTGTGCCATCTTTTGTCCCGTCTGTACACACTGCCGCCTGTTTCGTCTGCCTCGCTCACCCGCTCAACGAGGGGCACATAGGACTTAGCAAAGGCATCACC
TTCTTGCGCCCCTTCGTCGAGAAGCATTCACCCGTCTCGTGGGCCGATGCCATCCAAATGGCTGGGGCACTCGCGGTTGAGCTCGCTGGTGGCCCCAAACTGGCCATGCGCTATGGCCGC
GTTGATGTCGAGGCTGCAGCCGTCGACGGCAATCTTCCCGATGCCATGGCCTCCAATCCCGCTCAACACTTGCGCCAG
GTATGCTGCCGGCCTGCCCGCCTCAATCTTTAGCCTATGTGC
ATCCTTTCTTTATAATGGCGCGTGCGTAGGTGTTTGAGCGCATGGGGTTTAATGACCGGGACATTGTAGCCCTCAGTGGTGCGCACACAATTGGACGTGCCTTCAAAGTAAGCCGACAGC
CCTCGATTCGCCGCCCACCAATCATCTGCGTCTTGATGGTTCCTCTCACCATCCTTGCCTGCCAATAGGGTCGCTCGGGCGTCACCAACAACGGGTATGGCGATGAAGCAGCTACTCGAT
ACACCAAGAGCTCAGCCGTTGCTCGCGCTGATGGCCGTGCCGGCGTGGGCATGCCAG
GTTGGTTGCACTTGCCAACGCCGAGTTCCCCTCGAAAAATTGCTGGGTTCGACCCTGCGCTTA
ACCCCAAGCACGCTTCTCATATGCATTGAATGCCCATCTTGGGCACACACACACACACACACACACACACACACACACACACATAGGCGGTCGCTCATGGACTCCCAACTGGCTCACTTT
CGACAACAGCTATTTTATCGAG
GTACTCGGCACTCCTCGCCCCGTATTTTGCGCGCGCGTGCGCTGCCGGACCCTCGTTTCTGTCTTCGCACGACTTGCTATGCTGTGATCGAGCTGAGT
GGGGCACCATTGAAGCCGTTTTTTCTTCACCTTGACCTTTCACCGCCACTTCTTCACCCACAGAGCCTGCGCCAGCCACGCGAAGAGCTGTTATGGATGGCCACGGACCAGGCCCTGCAC
GAGGACCCACGCTTTCGGCCCCATTTCGAAGAGTTTGCACGCGATCAAGACGCCTTCTTTCACGCCTACGCTCAAGCGCACAAGCGTCTCAGCGAATTGGGCTCCAACTTTCTGTTTGAT
ATCACAGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCACAACTCAATTGGTCGTCGGAATCAGCTGAAAGCGCTCAAAGTAGATCTTGCCGCCTTTATTAACGAGAAGAACTGCCACCCCATCCTCCTTCGCCTTGCCTGGCACGATGCT
GGTACCTTTGATCGCCACG
CCCCATCGGACCGCTGTGGGGGCGCCAATGGCAGCATTCGCCTTCAGGAGGAGATGGGGCATGGCGCCAACGCCGGACTTAGCAAAGGCATCACCTTCTTG
CGCCCCTTCGTCGAGAAGCATTCACCCGTCTCGTGGGCCGATGCCATCCAAATGGCTGGGGCACTCGCGGTTGAGCTCGCTGGTGGCCCCAAACTGGCCATGCGCTATGGCCGCGTTGAT
GTCGAGGCTGCAGCCGTCGACGGCAATCTTCCCGATGCCATGGCCTCCAATCCCGCTCAACACTTGCGCCAG
GTGTTTGAGCGCATGGGGTTTAATGACCGGGACATTGTAGCCCTCAGT
GGTGCGCACACAATTGGACGTGCCTTCAAA
GGTCGCTCGGGCGTCACCAACAACGGGTATGGCGATGAAGCAGCTACTCGATACACCAAGAGCTCAGCCGTTGCTCGCGCTGATGGCCGT
GCCGGCGTGGGCATGCCAG
GCGGTCGCTCATGGACTCCCAACTGGCTCACTTTCGACAACAGCTATTTTATCGAGAGCCTGCGCCAGCCACGCGAAGAGCTGTTATGGATGGCCACGGAC
CAGGCCCTGCACGAGGACCCACGCTTTCGGCCCCATTTCGAAGAGTTTGCACGCGATCAAGACGCCTTCTTTCACGCCTACGCTCAAGCGCACAAGCGTCTCAGCGAATTGGGCTCCAAC
TTTCTGTTTGATATCACAGTCTAG

Retrieve as FASTA