Entry information : PpaPrx35 (PP00081G00840)
Entry ID 6308
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: PpaPrx35 (PP00081G00840)
Name (synonym) PpaPrx35 (PP00081G00840)
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx35
start..stop
S start..stop
PpaPrx29 315 7e-108 1..313 16..321
PpaPrx14 287 1e-96 15..313 41..336
PpaPrx51 284 1e-95 1..313 16..319
PpaPrx07 283 5e-95 19..313 31..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1009528..1009719 192 N° 2 1009840..1010019 180 N° 3 1010134..1010299 166 N° 4 1010428..1010831 404
join(1009528..1009719,1009840..1010019,1010134..1010299,1010428..1010831)


exon

Literature and cross-references PpaPrx35 (PP00081G00840)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008)
DNA ref. Phytozome 12:   scaffold_81 (1009528..1010831)
Protein sequence: PpaPrx35 (PP00081G00840)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313
PWM (Da):   %s   34612.33  
PI (pH):   %s   6.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILGVMSTIPVNTEDGADLHYDFFEHNCPEVENIVCNPIYESYLKNSTIAPGVLRMAYHDCFVRGCDASLLLEGPDSEKSHPINAPMHGFEAIDAAKEEVEKACPGVVSCADVLQFAVRDVVILTGGCDWRVLAGRRDGLVSNSTEVPKNILAPDKKVSDLLQAFQKKGFNAAQMVTLTGAHTIGRASWFAFDVRIHNFSGDQSKVDPSLPPLFASILKKKCPSANLTKWVNLEVITPRRFDTQYYKNLIHKIGLLTSDMSMVADSHTQEQVYMNTNWQKFSSNFADAMVDLSKLDVLTVQSGEIRLKCRFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Ecotype="Gransden 2004". Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATATTGGGCGTAATGAGTACGATCCCAGTAAATACTGAAGATGGTGCTGATCTACATTATGACTTCTTCGAGCATAATTGTCCAGAAGTTGAAAACATTGTCTGTAATCCAATATAC
GAATCTTACCTGAAGAACAGCACGATTGCGCCTGGTGTCCTTCGGATGGCATATCATGACTGTTTCGTTCGT
GTAAGTGTCTCCTCGACGATATAGATGTAATTTATGCAATTTTTCATG
ATTACCCAACCAGGTCAGGTTGATCACTGATTGTTGAGCGGGCGTTGTGCCCATGCCGTGTCTTCGGATCAGGGTTGCGACGCATCATTGCTCCTGGAGGGTCCCGATTCAGAGAAATCG
CATCCCATCAACGCTCCCATGCATGGCTTCGAAGCAATAGATGCTGCGAAGGAAGAAGTGGAGAAAGCCTGTCCTGGAGTTGTATCATGCGCAGATGTCTTGCAGTTCGCTGTTCGCGAC
GTTGTCATACTG
GTATGATACACTCTAAGTTGTCAAGAGTAGTCCATCTAAGATAACAGTGTATCCGTTAACATCATTGAATTTCACAATGTACAAGACTTGATGGAGCTTGAATCGTTT
GTGTAGACAGGAGGCTGCGATTGGCGGGTCCTAGCTGGGCGCAGAGACGGATTGGTGTCGAATTCTACTGAGGTCCCAAAAAACATACTAGCCCCAGATAAGAAAGTATCAGATCTACTG
CAGGCTTTCCAGAAGAAAGGATTCAACGCTGCTCAAATGGTCACTCTAACAG
GTATCGAGTCTAGTGATCTTTCCTCGCACATATAAACATCAATGATCTGCAGTTGCAACACCGTATAC
CAAAATCATTCCTATCAAGAGTTTAAATCAATTCATGACAATTCAGATTTCGTTTTGTAGGTGCTCATACCATCGGCAGAGCCTCCTGGTTTGCCTTCGACGTCCGAATCCACAATTTCA
GTGGTGATCAATCAAAGGTCGATCCATCTCTACCACCTCTTTTTGCATCCATCTTGAAGAAGAAATGCCCTTCGGCAAACCTGACGAAGTGGGTCAACCTGGAGGTAATCACCCCACGCA
GATTTGACACCCAGTATTACAAAAATCTCATCCACAAAATCGGTTTGCTCACCTCCGACATGAGCATGGTGGCGGACTCGCACACGCAGGAGCAGGTTTACATGAACACCAACTGGCAAA
AGTTCAGCTCAAACTTTGCGGATGCAATGGTTGATCTAAGCAAGCTCGATGTCCTGACAGTTCAGTCTGGTGAGATCCGGTTAAAATGCCGATTCGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATATTGGGCGTAATGAGTACGATCCCAGTAAATACTGAAGATGGTGCTGATCTACATTATGACTTCTTCGAGCATAATTGTCCAGAAGTTGAAAACATTGTCTGTAATCCAATATAC
GAATCTTACCTGAAGAACAGCACGATTGCGCCTGGTGTCCTTCGGATGGCATATCATGACTGTTTCGTTCGT
GGTTGCGACGCATCATTGCTCCTGGAGGGTCCCGATTCAGAGAAATCG
CATCCCATCAACGCTCCCATGCATGGCTTCGAAGCAATAGATGCTGCGAAGGAAGAAGTGGAGAAAGCCTGTCCTGGAGTTGTATCATGCGCAGATGTCTTGCAGTTCGCTGTTCGCGAC
GTTGTCATACTG
ACAGGAGGCTGCGATTGGCGGGTCCTAGCTGGGCGCAGAGACGGATTGGTGTCGAATTCTACTGAGGTCCCAAAAAACATACTAGCCCCAGATAAGAAAGTATCAGAT
CTACTGCAGGCTTTCCAGAAGAAAGGATTCAACGCTGCTCAAATGGTCACTCTAACAG
GTGCTCATACCATCGGCAGAGCCTCCTGGTTTGCCTTCGACGTCCGAATCCACAATTTCAGT
GGTGATCAATCAAAGGTCGATCCATCTCTACCACCTCTTTTTGCATCCATCTTGAAGAAGAAATGCCCTTCGGCAAACCTGACGAAGTGGGTCAACCTGGAGGTAATCACCCCACGCAGA
TTTGACACCCAGTATTACAAAAATCTCATCCACAAAATCGGTTTGCTCACCTCCGACATGAGCATGGTGGCGGACTCGCACACGCAGGAGCAGGTTTACATGAACACCAACTGGCAAAAG
TTCAGCTCAAACTTTGCGGATGCAATGGTTGATCTAAGCAAGCTCGATGTCCTGACAGTTCAGTCTGGTGAGATCCGGTTAAAATGCCGATTCGTGAACTAA

Retrieve as FASTA