Entry information : PpaPrx37 (PP00256G00280)
Entry ID 6310
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: PpaPrx37 (PP00256G00280)
Name (synonym) PpaPrx37 (PP00256G00280)
Class Class III peroxidase    [Orthogroup: Prx094]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx37
start..stop
S start..stop
PpaPrx41 575 0 31..374 59..401
PpaPrx15 536 0 31..370 68..407
PpaPrx26 417 7e-146 31..364 47..386
PpaPrx32 302 2e-101 40..337 43..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 289231..289680 450 N° 2 289795..290469 675  
join(289231..289680,289795..290469)


exon

Literature and cross-references PpaPrx37 (PP00256G00280)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_256 (289231..290469)
Protein sequence: PpaPrx37 (PP00256G00280)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   40625.18  
PI (pH):   %s   6.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDATFFKLEHLIQPRHPNRALQLHRHFPHAPRGKDVYGGPPLDYDFYTTMSPSFQQIVKSEVAKAMLADSLTPAQLLRLFFHDCFVMGCDASLLLKSTVLNLAERDHPSNFTVDKFSVIDAIKAELEKACPGIVSCADIVGAAAVEAVEQAGGPHIDLAYGRRDGLDSFGQAAKTNLPGSTLQVEGLRENFANVGLNLTDMVVLSGGHTIGQARCSSFADRFAPAAKNPFPDTIFGQELNAYCVEGNRLGIDRRMTLDANSTTIFDNGYFQSIVAGRGILTTDNVLFTDNRTKSLVTTFAQDQTVFFDAFKELMAKMGRIGVLTGTQGQIRKQCWVRNPIDPATTPDANMEFAPASLEFCTPNPCPATCSSNTA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2). No EST. Ecotype="Gransden 2004". Incorrect prediction from Phytozome (shorter PS). Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCAACCTTCTTCAAGCTGGAGCACCTAATCCAGCCCCGGCACCCGAACAGGGCGCTCCAGCTCCATCGTCACTTCCCACACGCCCCACGGGGTAAAGACGTCTACGGCGGACCG
CCACTGGATTATGATTTTTACACCACGATGAGCCCTTCGTTTCAGCAGATTGTGAAGAGCGAGGTCGCCAAAGCTATGCTTGCAGATTCCCTTACTCCCGCGCAGCTGCTTCGTTTATTC
TTCCACGACTGTTTCGTGATGGGATGCGACGCGTCTCTCTTACTGAAATCCACCGTGCTGAACCTCGCAGAGAGGGACCATCCAAGCAACTTCACGGTGGATAAGTTTTCCGTCATCGAC
GCTATCAAGGCTGAGCTCGAGAAGGCTTGCCCTGGCATTGTGTCGTGTGCTGACATTGTGGGTGCTGCTGCTGTAGAAGCTGTGGAACAG
GTAAGGTTTCCCCTGTCATGTTTGCTATAG
TTTCGTTTCGAGTGTGAGGTCTTTTACATGGTTCTCGAACAATCAGCTCGACTATGTCTCTTAATGTCTGGTCCTCGCTGCCAGGCCGGAGGACCTCACATCGACCTTGCATATGGTCGA
AGGGACGGCCTTGACTCGTTTGGGCAAGCTGCGAAGACGAATCTACCCGGCAGCACGCTTCAAGTCGAGGGCCTACGAGAAAACTTCGCAAACGTGGGTCTGAATCTCACAGACATGGTG
GTGCTCTCAGGAGGTCATACAATTGGTCAAGCCCGCTGCTCCTCATTCGCGGACCGATTCGCACCTGCAGCGAAGAACCCATTCCCCGACACTATATTCGGCCAAGAGCTCAATGCTTAC
TGTGTCGAAGGCAACAGACTAGGAATCGATCGCCGAATGACGCTCGACGCCAACAGCACCACAATCTTCGACAACGGCTACTTCCAGAGCATCGTTGCAGGCCGCGGCATACTGACAACC
GACAACGTCCTCTTCACCGATAACCGCACTAAATCCCTGGTCACTACCTTCGCGCAGGACCAGACTGTGTTCTTCGATGCATTCAAGGAGTTGATGGCGAAGATGGGCCGCATTGGTGTG
CTGACCGGCACTCAGGGGCAGATTCGCAAGCAGTGCTGGGTGCGCAACCCCATTGACCCCGCAACCACGCCCGACGCGAACATGGAGTTCGCGCCTGCGAGCTTAGAGTTCTGCACGCCT
AATCCTTGCCCTGCCACATGCTCCAGCAACACTGCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACGCAACCTTCTTCAAGCTGGAGCACCTAATCCAGCCCCGGCACCCGAACAGGGCGCTCCAGCTCCATCGTCACTTCCCACACGCCCCACGGGGTAAAGACGTCTACGGCGGACCG
CCACTGGATTATGATTTTTACACCACGATGAGCCCTTCGTTTCAGCAGATTGTGAAGAGCGAGGTCGCCAAAGCTATGCTTGCAGATTCCCTTACTCCCGCGCAGCTGCTTCGTTTATTC
TTCCACGACTGTTTCGTGATGGGATGCGACGCGTCTCTCTTACTGAAATCCACCGTGCTGAACCTCGCAGAGAGGGACCATCCAAGCAACTTCACGGTGGATAAGTTTTCCGTCATCGAC
GCTATCAAGGCTGAGCTCGAGAAGGCTTGCCCTGGCATTGTGTCGTGTGCTGACATTGTGGGTGCTGCTGCTGTAGAAGCTGTGGAACAG
GCCGGAGGACCTCACATCGACCTTGCATAT
GGTCGAAGGGACGGCCTTGACTCGTTTGGGCAAGCTGCGAAGACGAATCTACCCGGCAGCACGCTTCAAGTCGAGGGCCTACGAGAAAACTTCGCAAACGTGGGTCTGAATCTCACAGAC
ATGGTGGTGCTCTCAGGAGGTCATACAATTGGTCAAGCCCGCTGCTCCTCATTCGCGGACCGATTCGCACCTGCAGCGAAGAACCCATTCCCCGACACTATATTCGGCCAAGAGCTCAAT
GCTTACTGTGTCGAAGGCAACAGACTAGGAATCGATCGCCGAATGACGCTCGACGCCAACAGCACCACAATCTTCGACAACGGCTACTTCCAGAGCATCGTTGCAGGCCGCGGCATACTG
ACAACCGACAACGTCCTCTTCACCGATAACCGCACTAAATCCCTGGTCACTACCTTCGCGCAGGACCAGACTGTGTTCTTCGATGCATTCAAGGAGTTGATGGCGAAGATGGGCCGCATT
GGTGTGCTGACCGGCACTCAGGGGCAGATTCGCAAGCAGTGCTGGGTGCGCAACCCCATTGACCCCGCAACCACGCCCGACGCGAACATGGAGTTCGCGCCTGCGAGCTTAGAGTTCTGC
ACGCCTAATCCTTGCCCTGCCACATGCTCCAGCAACACTGCATAG

Retrieve as FASTA