Entry information : PpaPrx38 (PP00001G01590)
Entry ID 6311
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx38 (PP00001G01590)
Name (synonym) PpaPrx38 (PP00001G01590)
Class Class III peroxidase    [Orthogroup: Prx108]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx38
start..stop
S start..stop
PpaPrx22 586 0 1..342 1..342
SmPrx08-1_40 355 5e-123 38..342 24..328
SmPrx08-2_107 346 3e-119 24..342 12..326
PabPrx121 338 4e-116 39..342 28..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1929067..1929333 267 N° 2 1928637..1928825 189 N° 3 1927922..1928494 573  
complement(join(1927922..1928494,1928637..1928825,1929067..1929333))


exon

Literature and cross-references PpaPrx38 (PP00001G01590)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008)
DNA ref. Phytozome 12:   scaffold_1 (1929333..1927922)
Protein sequence: PpaPrx38 (PP00001G01590)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (309)
PWM (Da):   %s   37382.57 (33677.9)  
PI (pH):   %s   7.89 (8.40) Peptide Signal:   %s   cut: 34 range:34-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAHFQIGEGFKWEAAFFCCWVLCWVAVSSNAEGRAVNASTRPKLNRLFYSHSCPRLEHVVSSTMARHLQQNIASGAPLLRMFFHDCAVNGCDASVLIDSTPNNTAERDAIPNQTVRGYHIVDDIKSQVEVMCPGIVSCADIIALASRDAVVLAGGPTWHVELGRRDGRISRADQAGSQLPSSQSTAESLITQFAALGLTPRDMATLSGAHTFGRVHCAQVARRFFGFNSTTGYDPLLSDTYATKLRTMCPQPVDGTSRIPTEPITPDQFDEHYYTAVLQDRGILTSDSSLLVNAKTGRYVKEYAQNRTVFFERFAAAMLKMGRFGVKLGTEGEIRRVCSAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST. Ecotype="Gransden 2004".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCATTTTCAGATCGGGGAAGGATTCAAATGGGAAGCTGCATTTTTCTGCTGTTGGGTTTTATGCTGGGTCGCGGTTAGTTCTAATGCTGAAGGTCGCGCTGTCAACGCAAGTACG
AGACCTAAGCTGAACAGATTATTCTATAGCCATAGTTGTCCGAGATTGGAGCATGTAGTGTCGTCCACTATGGCTAGGCACTTGCAACAAAACATCGCTTCTGGTGCTCCTCTGCTTCGC
ATGTTCTTCCACGATTGTGCTGTCAAT
GTGAGCTGCCATTCCAACCTTGATCTCGTGAACTAACTATTCGCCTGGTACCCTTCATTCATTATGAGCTCGCTTTAGTACACTGGGTAAGTG
GCAGAAAGGAGCTCGAGAAACCAGAACTTAAGGCAAATAATTCTCTTCATAACTATCAGTTTTTGCAGTGCGGATCTGAATCAAGTTCAATTTAACGGATGCGTAAGTATTCATTCAATG
ATGCAGTGGCAATGATCTTAATTCACAGGGATGCGATGCGTCAGTGTTGATCGATTCAACTCCTAACAACACCGCAGAGCGCGATGCAATACCGAACCAGACCGTGAGAGGATACCATAT
CGTCGATGACATCAAGAGCCAGGTTGAGGTCATGTGCCCCGGCATTGTGTCCTGTGCCGACATTATTGCTCTCGCAAGCCGTGATGCAGTTGTGCTG
GTAATTTTTGCTACAGATCCTTG
ATAATCGTTTTCTTCACGATTTGCTACGTTCATGAACATCTATGTCACAGAGATTGATTATACGCTGCAGGGACGATAATGAATGGAATTCTGATTCGTTTACTCATCGATTTGAACAGG
CAGGAGGGCCAACATGGCATGTAGAGCTTGGGCGAAGAGACGGCCGCATTTCCAGAGCTGATCAAGCAGGAAGTCAGCTACCGTCTTCGCAATCCACTGCCGAGTCTCTCATCACGCAGT
TCGCTGCGCTGGGCTTGACTCCCCGCGACATGGCCACATTGTCTGGGGCGCACACTTTTGGAAGAGTGCATTGTGCGCAAGTGGCAAGACGATTCTTTGGGTTCAACAGCACAACGGGGT
ACGATCCTCTACTCTCTGACACCTACGCTACCAAGCTGCGCACAATGTGTCCCCAACCCGTGGACGGCACATCACGCATCCCGACGGAGCCCATCACCCCCGACCAGTTCGACGAGCACT
ACTACACGGCGGTGTTGCAAGATCGAGGCATTTTGACATCGGATTCGTCCCTGCTCGTCAACGCGAAAACAGGACGGTACGTGAAGGAGTATGCCCAAAACCGAACTGTTTTTTTCGAGC
GGTTCGCTGCAGCCATGCTCAAAATGGGCCGCTTTGGGGTGAAGCTGGGCACCGAAGGAGAAATTCGGAGAGTGTGCTCTGCTGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCATTTTCAGATCGGGGAAGGATTCAAATGGGAAGCTGCATTTTTCTGCTGTTGGGTTTTATGCTGGGTCGCGGTTAGTTCTAATGCTGAAGGTCGCGCTGTCAACGCAAGTACG
AGACCTAAGCTGAACAGATTATTCTATAGCCATAGTTGTCCGAGATTGGAGCATGTAGTGTCGTCCACTATGGCTAGGCACTTGCAACAAAACATCGCTTCTGGTGCTCCTCTGCTTCGC
ATGTTCTTCCACGATTGTGCTGTCAAT
GGATGCGATGCGTCAGTGTTGATCGATTCAACTCCTAACAACACCGCAGAGCGCGATGCAATACCGAACCAGACCGTGAGAGGATACCATATC
GTCGATGACATCAAGAGCCAGGTTGAGGTCATGTGCCCCGGCATTGTGTCCTGTGCCGACATTATTGCTCTCGCAAGCCGTGATGCAGTTGTGCTG
GCAGGAGGGCCAACATGGCATGTA
GAGCTTGGGCGAAGAGACGGCCGCATTTCCAGAGCTGATCAAGCAGGAAGTCAGCTACCGTCTTCGCAATCCACTGCCGAGTCTCTCATCACGCAGTTCGCTGCGCTGGGCTTGACTCCC
CGCGACATGGCCACATTGTCTGGGGCGCACACTTTTGGAAGAGTGCATTGTGCGCAAGTGGCAAGACGATTCTTTGGGTTCAACAGCACAACGGGGTACGATCCTCTACTCTCTGACACC
TACGCTACCAAGCTGCGCACAATGTGTCCCCAACCCGTGGACGGCACATCACGCATCCCGACGGAGCCCATCACCCCCGACCAGTTCGACGAGCACTACTACACGGCGGTGTTGCAAGAT
CGAGGCATTTTGACATCGGATTCGTCCCTGCTCGTCAACGCGAAAACAGGACGGTACGTGAAGGAGTATGCCCAAAACCGAACTGTTTTTTTCGAGCGGTTCGCTGCAGCCATGCTCAAA
ATGGGCCGCTTTGGGGTGAAGCTGGGCACCGAAGGAGAAATTCGGAGAGTGTGCTCTGCTGTGAACTGA

Retrieve as FASTA