Entry information : PpaPrx41
Entry ID 6314
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2012-01-05 (Toky Ramarohetra)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-31 (Qiang Li)
Peroxidase information: PpaPrx41
Name PpaPrx41
Class Class III peroxidase    [Orthogroup: Prx094]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx41
start..stop
S start..stop
PpaPrx15 602 0 4..401 3..411
PpaPrx37 557 0 59..401 31..374
PpaPrx26 430 2e-150 4..395 3..395
PpaPrx32 305 4e-102 45..364 18..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 980726..981259 534 N° 2 979938..980609 672  
complement(join(979938..980609,980726..981259))


exon

Literature and cross-references PpaPrx41
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_56 (981259..979938)
EST ref. GenBank:   FC399078.1 [Fragment]
Protein sequence: PpaPrx41
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   401 (380)
PWM (Da):   %s   42159.2 (40088.0)  
PI (pH):   %s   6.04 (5.71) Peptide Signal:   %s   cut: 22 range:22-401
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSSLLLIGVICSLLALSASAEECPFSGRRNLLQAGAPGAAPPAQQGGAPAPAAVGPRPVGKDVYGEPALDYDFYTTKCPTFLQIVKTEVAKAIAADSLTPAQLLRLFFHDCFVMGCDASLLLKSTKVNLAERDHPNNFTVDKFTVIDAIKAELEKACPGIVSCADILGAAAAEAVEQGGPHIDLAFGRRDGLDSFALAAKTNLPGSTLKVVGLVENFANVGLNKTDMVVLSGGHTIGQARCSTFADRFAPGVKNPFPDTKFGEALQTYCTDGNTAGLDRRMTLDANSTTVFDNGYFRSIVAGRGILTSDHVLFTDPSTKPLVTLFAANQDAFFAAFKESMAKMGRIGVLTGTQGQIRKQCWVRNPVDITTTPDANMDFAPVSSEFCKPASCDATCASPTS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2) and 1 EST. Strain="Villersexel 2003".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCGTCGCTGCTGCTGATCGGAGTGATCTGTAGCTTGTTAGCTTTGAGTGCTTCCGCCGAGGAGTGTCCATTCAGCGGTCGGCGCAACCTCCTCCAAGCTGGAGCTCCTGGTGCA
GCCCCGCCGGCACAGCAGGGTGGTGCTCCTGCTCCAGCGGCAGTTGGCCCACGCCCAGTGGGTAAGGATGTGTACGGCGAGCCGGCGCTGGATTACGATTTCTACACCACCAAGTGCCCC
ACCTTTCTGCAGATTGTGAAGACGGAGGTTGCCAAAGCTATCGCCGCTGACTCCCTCACCCCCGCCCAGCTGCTGCGTTTGTTTTTCCACGACTGCTTCGTGATGGGATGCGACGCGTCG
CTGCTGCTCAAGTCCACCAAGGTGAATCTGGCGGAGCGGGACCACCCCAACAATTTCACCGTCGACAAATTTACCGTCATCGACGCCATCAAGGCCGAGCTGGAAAAGGCGTGCCCGGGG
ATTGTGTCGTGCGCGGACATTCTGGGAGCCGCCGCTGCGGAGGCTGTGGAACAG
GTAAGTTTGTCGCTATTCTTGTTGTGACTGTCGTTTCGGGACGGGGGCTTGTTGTTTGTCTCGAAC
ACGATCGGCTCAACCATGGCTCATGATGTCGGGTTTTCTGGTGCCAGGCGGGAGGACCTCACATCGATCTAGCATTCGGCCGAAGGGATGGGCTGGACTCTTTTGCGCTTGCTGCGAAGA
CCAATCTGCCCGGCAGCACCTTGAAAGTAGTGGGACTGGTCGAGAACTTCGCCAATGTCGGGCTGAACAAGACCGACATGGTGGTGCTGTCCGGAGGTCACACGATCGGTCAAGCCCGCT
GCTCCACGTTCGCCGACAGATTCGCGCCCGGGGTGAAGAACCCTTTCCCCGACACCAAATTCGGCGAAGCCCTCCAAACCTACTGCACAGACGGCAACACGGCGGGGCTGGACCGCAGAA
TGACGCTGGACGCCAACAGCACCACGGTCTTCGACAACGGCTACTTCAGGAGCATAGTCGCGGGCCGCGGCATCTTAACATCCGACCACGTCCTGTTCACCGATCCGAGCACCAAGCCGC
TTGTCACTCTGTTCGCGGCGAACCAGGATGCGTTCTTCGCCGCTTTCAAGGAGTCCATGGCGAAGATGGGCCGCATCGGGGTGCTGACGGGCACGCAGGGGCAGATTCGCAAACAGTGCT
GGGTGCGCAACCCGGTCGACATCACGACCACGCCCGACGCGAACATGGACTTCGCTCCAGTGAGTTCCGAGTTCTGCAAGCCAGCGTCATGCGACGCCACGTGCGCCAGTCCTACTTCAT
AG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTCGTCGCTGCTGCTGATCGGAGTGATCTGTAGCTTGTTAGCTTTGAGTGCTTCCGCCGAGGAGTGTCCATTCAGCGGTCGGCGCAACCTCCTCCAAGCTGGAGCTCCTGGTGCA
GCCCCGCCGGCACAGCAGGGTGGTGCTCCTGCTCCAGCGGCAGTTGGCCCACGCCCAGTGGGTAAGGATGTGTACGGCGAGCCGGCGCTGGATTACGATTTCTACACCACCAAGTGCCCC
ACCTTTCTGCAGATTGTGAAGACGGAGGTTGCCAAAGCTATCGCCGCTGACTCCCTCACCCCCGCCCAGCTGCTGCGTTTGTTTTTCCACGACTGCTTCGTGATGGGATGCGACGCGTCG
CTGCTGCTCAAGTCCACCAAGGTGAATCTGGCGGAGCGGGACCACCCCAACAATTTCACCGTCGACAAATTTACCGTCATCGACGCCATCAAGGCCGAGCTGGAAAAGGCGTGCCCGGGG
ATTGTGTCGTGCGCGGACATTCTGGGAGCCGCCGCTGCGGAGGCTGTGGAACAG
GGAGGACCTCACATCGATCTAGCATTCGGCCGAAGGGATGGGCTGGACTCTTTTGCGCTTGCTGCG
AAGACCAATCTGCCCGGCAGCACCTTGAAAGTAGTGGGACTGGTCGAGAACTTCGCCAATGTCGGGCTGAACAAGACCGACATGGTGGTGCTGTCCGGAGGTCACACGATCGGTCAAGCC
CGCTGCTCCACGTTCGCCGACAGATTCGCGCCCGGGGTGAAGAACCCTTTCCCCGACACCAAATTCGGCGAAGCCCTCCAAACCTACTGCACAGACGGCAACACGGCGGGGCTGGACCGC
AGAATGACGCTGGACGCCAACAGCACCACGGTCTTCGACAACGGCTACTTCAGGAGCATAGTCGCGGGCCGCGGCATCTTAACATCCGACCACGTCCTGTTCACCGATCCGAGCACCAAG
CCGCTTGTCACTCTGTTCGCGGCGAACCAGGATGCGTTCTTCGCCGCTTTCAAGGAGTCCATGGCGAAGATGGGCCGCATCGGGGTGCTGACGGGCACGCAGGGGCAGATTCGCAAACAG
TGCTGGGTGCGCAACCCGGTCGACATCACGACCACGCCCGACGCGAACATGGACTTCGCTCCAGTGAGTTCCGAGTTCTGCAAGCCAGCGTCATGCGACGCCACGTGCGCCAGTCCTACT
TCATAG

Retrieve as FASTA