Entry information : PpaPrx43 (PP00309G00500)
Entry ID 6316
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2008-08-06 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: PpaPrx43 (PP00309G00500)
Name (synonym) PpaPrx43 (PP00309G00500)
Class Class III peroxidase    [Orthogroup: Prx051]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx43
start..stop
S start..stop
PpaPrx53 585 0 1..335 1..336
PpaPrx13 585 0 1..335 1..336
PpaPrx[P]13 432 1e-153 1..335 1..308
PpaPrx07 313 2e-106 16..334 12..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 486058..486306 249 N° 2 485675..485860 186 N° 3 484950..485522 573  
complement(join(484950..485522,485675..485860,486058..486306))


exon

Literature and cross-references PpaPrx43 (PP00309G00500)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008)
DNA ref. Phytozome 12:   scaffold_309 (486306..484950)
EST ref. GenBank:   BJ964874.1 [5' end]
Protein sequence: PpaPrx43 (PP00309G00500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   37153.71 (32884.8)  
PI (pH):   %s   5.93 (9.33) Peptide Signal:   %s   cut: 32 range:32-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAFDPMGPSKMQVLLMTVALAMFLSGEVEATAYNLRPHYYRGKCGRHDVEKIIYNAVAQAFRQDNGVAPGIVRLAYHDYFVRGCDASLLLDTPNSEKTAPINRGLRAIAFNAIDTAKAAVESVCPGVVSCADVLQYATRDSVLLIKGKGWTVYGGRKHGTVSNSADPPINLPVETQTSSQMIPIFVSKGLSADDLVALSGGHTIGIAHCTFVSPRIYGNNTDPKIPADFLASLKRQCPADSVTTNPPIGAPIDLDLVSPTKFDSQYFQNIIQRKGLLTSDQSLLDDSRSRNAVYKNNGRFFNSEFGRAMQAMARVGVLTGNQGQIRKNCRALNP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1 and 2) and 1 EST. Ecotype="Gransden 2004". Incorrect prediction from Phytozome (PS is missing). Missing 'c'. containing motif yhdy.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCTTTTGATCCGATGGGTCCATCGAAAATGCAAGTTCTGCTGATGACAGTGGCGCTTGCCATGTTCTTGAGCGGCGAAGTGGAAGCGACTGCATACAACCTTCGACCACATTAT
TACCGGGGCAAGTGCGGCAGACATGATGTAGAAAAGATAATTTACAATGCGGTTGCGCAGGCATTTCGACAGGACAATGGAGTAGCCCCCGGCATTGTGAGGCTGGCGTACCATGATTAT
TTCGTTCGT
GTAAGTGTACTCTCCCCTTTGTCCTGCCACTTCGTCCAGTAGTAGTTATTTGTGTGGGCTACGTCAATGCGCTTGCGTTTTTGCAAGTTTGCGGGCACACGTTGGAGGATC
ATATTATGTCCTGTAATGATGTGGTTTCGCACTCAATTAAGATCAGAGCATATGGATCCATCTGAAGTTGGATGTTTCTTTTTCAGGGCTGTGACGCCTCATTGCTGCTTGACACACCCA
ATTCTGAGAAGACTGCACCTATCAACAGAGGTCTTCGGGCGATCGCTTTCAACGCGATAGACACTGCGAAAGCCGCCGTGGAAAGTGTTTGTCCAGGGGTTGTTTCTTGTGCTGACGTTC
TACAATACGCTACTCGCGACTCTGTGCTGCTG
GTGCTGCTCACTTGATCCTGAATTGAATATGTCGCCACTGATTAACCCTGGAAAATATGTATCTTCAGTTCAAGCTTCCGTAGTATTT
TGCCTTGGAACTCAGAGCTTCAAGACAATCACTGAACATGATATCATTTGTATGTCGATTGCAGATTAAAGGTAAAGGCTGGACTGTGTATGGCGGTCGAAAACACGGAACTGTGTCCAA
CTCTGCCGACCCCCCCATTAACCTGCCAGTGGAAACTCAGACGTCTAGTCAGATGATTCCTATTTTCGTCAGCAAAGGACTGAGTGCCGATGATTTGGTGGCTTTGTCAGGCGGTCACAC
CATCGGAATTGCTCACTGTACTTTCGTGAGCCCTCGCATCTACGGGAATAACACTGATCCGAAGATTCCAGCCGACTTCCTGGCATCGTTGAAGCGTCAGTGCCCCGCGGATTCTGTCAC
CACTAACCCGCCCATTGGAGCCCCGATCGACCTCGACCTAGTTTCGCCTACCAAGTTCGACTCGCAGTACTTCCAGAACATTATCCAGAGGAAGGGCTTGCTCACATCCGACCAAAGCCT
GCTGGACGACTCCAGAAGCAGGAATGCCGTGTACAAGAACAACGGAAGATTCTTCAACTCAGAATTCGGAAGGGCCATGCAAGCTATGGCTCGAGTCGGTGTACTCACTGGCAATCAAGG
CCAAATCCGTAAGAATTGTCGCGCTCTTAACCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGCTTTTGATCCGATGGGTCCATCGAAAATGCAAGTTCTGCTGATGACAGTGGCGCTTGCCATGTTCTTGAGCGGCGAAGTGGAAGCGACTGCATACAACCTTCGACCACATTAT
TACCGGGGCAAGTGCGGCAGACATGATGTAGAAAAGATAATTTACAATGCGGTTGCGCAGGCATTTCGACAGGACAATGGAGTAGCCCCCGGCATTGTGAGGCTGGCGTACCATGATTAT
TTCGTTCGT
GGCTGTGACGCCTCATTGCTGCTTGACACACCCAATTCTGAGAAGACTGCACCTATCAACAGAGGTCTTCGGGCGATCGCTTTCAACGCGATAGACACTGCGAAAGCCGCC
GTGGAAAGTGTTTGTCCAGGGGTTGTTTCTTGTGCTGACGTTCTACAATACGCTACTCGCGACTCTGTGCTGCTG
ATTAAAGGTAAAGGCTGGACTGTGTATGGCGGTCGAAAACACGGA
ACTGTGTCCAACTCTGCCGACCCCCCCATTAACCTGCCAGTGGAAACTCAGACGTCTAGTCAGATGATTCCTATTTTCGTCAGCAAAGGACTGAGTGCCGATGATTTGGTGGCTTTGTCA
GGCGGTCACACCATCGGAATTGCTCACTGTACTTTCGTGAGCCCTCGCATCTACGGGAATAACACTGATCCGAAGATTCCAGCCGACTTCCTGGCATCGTTGAAGCGTCAGTGCCCCGCG
GATTCTGTCACCACTAACCCGCCCATTGGAGCCCCGATCGACCTCGACCTAGTTTCGCCTACCAAGTTCGACTCGCAGTACTTCCAGAACATTATCCAGAGGAAGGGCTTGCTCACATCC
GACCAAAGCCTGCTGGACGACTCCAGAAGCAGGAATGCCGTGTACAAGAACAACGGAAGATTCTTCAACTCAGAATTCGGAAGGGCCATGCAAGCTATGGCTCGAGTCGGTGTACTCACT
GGCAATCAAGGCCAAATCCGTAAGAATTGTCGCGCTCTTAACCCTTAG

Retrieve as FASTA