Entry information : PpaPrx44 (PP00060G00530)
Entry ID 6317
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx44 (PP00060G00530)
Name (synonym) PpaPrx44 (PP00060G00530)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx44
start..stop
S start..stop
PpaPrx45 399 1e-140 2..318 13..332
MpPrx75 342 3e-118 9..315 26..332
GbPrx04 342 6e-118 18..314 32..329
PsiPrx17 336 2e-115 7..318 13..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 614323..614499 177 N° 2 613920..614111 192 N° 3 613613..613778 166 N° 4 613024..613457 434
complement(join(613024..613457,613613..613778,613920..614111,614323..614499))


exon

Literature and cross-references PpaPrx44 (PP00060G00530)
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_60 (614499..613024)
Protein sequence: PpaPrx44 (PP00060G00530)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322
PWM (Da):   %s   34699.23  
PI (pH):   %s   5.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMLVVVVKICAAELDVAYYDFRCPDALAIVQGGVHAAMQRDARAPASLLRLHFHDCFVNGCDGSNLLDDRPGFVGEKTAAPNLNSARGFEIIDEIKQQLEDACPKTVSCADIVAAAARDAVFLSGGPFWDVELGRRDALTTSSQAAVNSIPSPRFNVPQLIKSFNAVGLDKKDVVALSGSHTIGIARCASFQARLYNQGNSGRPDSSLEKHYLAELQNRCPQSGDGNQTAFLDPCTPTTFDNQYYKDLQAGRGLLFSDEVLETTSGTTLKLVELYATDQTAFFTDFVSSMLKMASIHVKADSEGEIRRNCRIPNSVNAKGGT

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST. Strain="Villersexel 2003".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTGGTGGTGGTGGTGAAGATTTGTGCCGCGGAGCTCGACGTCGCATACTATGACTTTCGGTGTCCCGATGCATTGGCCATCGTGCAAGGCGGCGTCCACGCCGCCATGCAGCGC
GACGCCCGGGCTCCTGCGTCACTTCTGCGGCTACACTTTCATGACTGCTTTGTGAAT
GTGCGTTCGAAAGTTGATGTGGAGTTCGTTGTGGATGGTTTTATCTGAGTGATGTGTGATGTT
CCGGTTTGCCGATGGGGGTCGTTAGACCGACGTTGTTCCTAGTGTTGATTTAGTTTGAGCTGTATGGGTTGGCTGTTATATATATATATTAGCTTTCTGGTGGATTAATTGTCGGGAATG
GCGGTTGAGGTTGGTTTGTGGCGAGCAGGGATGCGATGGCTCCAACCTGCTGGACGACCGACCAGGATTCGTTGGAGAGAAGACTGCGGCGCCGAACTTGAATTCTGCGCGAGGGTTTGA
AATAATTGATGAAATCAAGCAGCAGCTGGAAGATGCCTGCCCTAAGACTGTATCGTGCGCGGACATTGTAGCCGCAGCTGCTCGTGACGCAGTGTTTTTG
GTACTTTGTCATGCGTTACG
TTCTGAACTGATCGATGTCAAAATTGGATTGAATTCTGTTATATTTCTGCCAGTGTCAAGGTTCGAGGTATGTATGGAAAATCGAATCCCAATTTATTTCTGGGGGGTGCACGGATGACA
GAGTGGCGGGCCTTTCTGGGATGTGGAGTTGGGAAGACGAGATGCACTCACAACTAGCTCACAGGCTGCAGTAAATTCCATTCCTAGTCCGAGGTTCAATGTTCCCCAGCTGATCAAGAG
CTTCAACGCCGTGGGACTTGATAAGAAGGATGTTGTCGCACTTTCAG
GTATTCCACATGGAGGAAATACGCTAAACATGCAGAATTAACTAGAAGTTGATCGAATTCCCTTTCTCTTTTC
ATCTTTTATTTAATATGCACAATTCTCGACAGTCGGTTATTGAACTGAGAATAGAGCATCATGCTGTTTTCAAATACCTCAGGCTCGCACACGATTGGAATAGCACGATGCGCTAGCTTC
CAGGCACGTCTCTACAACCAAGGGAATTCGGGACGACCCGACTCATCCCTGGAGAAGCACTATCTTGCAGAGCTCCAGAACAGGTGCCCTCAAAGCGGCGACGGAAACCAGACTGCATTT
CTCGACCCATGCACACCAACAACCTTCGACAACCAATACTACAAGGATTTGCAGGCTGGTCGAGGCCTTCTGTTCTCGGACGAAGTGCTGGAAACCACCAGTGGCACAACCCTCAAGCTT
GTTGAGCTTTATGCCACGGACCAGACCGCATTCTTCACCGACTTCGTCTCATCGATGCTCAAGATGGCGTCCATCCACGTGAAAGCTGACAGCGAGGGCGAAATTCGCCGCAACTGCAGG
ATCCCGAACTCTGTGAATGCTAAGGGTGGAACCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGTTGGTGGTGGTGGTGAAGATTTGTGCCGCGGAGCTCGACGTCGCATACTATGACTTTCGGTGTCCCGATGCATTGGCCATCGTGCAAGGCGGCGTCCACGCCGCCATGCAGCGC
GACGCCCGGGCTCCTGCGTCACTTCTGCGGCTACACTTTCATGACTGCTTTGTGAAT
GGATGCGATGGCTCCAACCTGCTGGACGACCGACCAGGATTCGTTGGAGAGAAGACTGCGGCG
CCGAACTTGAATTCTGCGCGAGGGTTTGAAATAATTGATGAAATCAAGCAGCAGCTGGAAGATGCCTGCCCTAAGACTGTATCGTGCGCGGACATTGTAGCCGCAGCTGCTCGTGACGCA
GTGTTTTTG
AGTGGCGGGCCTTTCTGGGATGTGGAGTTGGGAAGACGAGATGCACTCACAACTAGCTCACAGGCTGCAGTAAATTCCATTCCTAGTCCGAGGTTCAATGTTCCCCAGCTG
ATCAAGAGCTTCAACGCCGTGGGACTTGATAAGAAGGATGTTGTCGCACTTTCAG
GCTCGCACACGATTGGAATAGCACGATGCGCTAGCTTCCAGGCACGTCTCTACAACCAAGGGAAT
TCGGGACGACCCGACTCATCCCTGGAGAAGCACTATCTTGCAGAGCTCCAGAACAGGTGCCCTCAAAGCGGCGACGGAAACCAGACTGCATTTCTCGACCCATGCACACCAACAACCTTC
GACAACCAATACTACAAGGATTTGCAGGCTGGTCGAGGCCTTCTGTTCTCGGACGAAGTGCTGGAAACCACCAGTGGCACAACCCTCAAGCTTGTTGAGCTTTATGCCACGGACCAGACC
GCATTCTTCACCGACTTCGTCTCATCGATGCTCAAGATGGCGTCCATCCACGTGAAAGCTGACAGCGAGGGCGAAATTCGCCGCAACTGCAGGATCCCGAACTCTGTGAATGCTAAGGGT
GGAACCTAA

Retrieve as FASTA