Entry information : Ppa1CysPrx02
Entry ID 6323
Creation 2008-08-08 (Christophe Dunand)
Last sequence changes 2011-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-02 (Christophe Dunand)
Peroxidase information: Ppa1CysPrx02
Name Ppa1CysPrx02
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type Protonema
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ppa1CysPrx02
start..stop
S start..stop
Tru1CysPrx 412 3e-149 1..221 1..218
Mp1CysPrx02 340 1e-120 1..221 1..220
Sm1CysPrx02-2_8 315 9e-111 4..221 3..220
Sm1CysPrx02-1_0 315 9e-111 4..221 3..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 737490..737610 121 N° 2 737771..737919 149 N° 3 738126..738272 147 N° 4 738468..738716 249
join(737490..737610,737771..737919,738126..738272,738468..738716)


exon

Literature and cross-references Ppa1CysPrx02
Literature Rensing,S.A. et al., The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants. Science 319 (5859), 64-69 (2008)
DNA ref. Phytozome 11:   scaffold_12 (737490..738716)
Cluster/Prediction ref. UniGene:   Ppa.18519
Protein sequence: Ppa1CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24208.22  
PI (pH):   %s   4.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGGWALGELVPDVEADSTVGHIKVRDYCKDGWTIIFSHPGDYTPVCTTELGKIAAYNPEFENRGVKLLGLSTDSVEDHLGWIEDIETYPGAPVLYPILADPDRKITVALNMMDPDEKDANGKPLASRALHIVGPDCRLKLSFLYPGTTGRNFDEVLRVLDSLQLASKHKIATPANWQPGEPVVISPSVSNEEAKELFPQGWETFKLPSGQPYLRMTFVE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 14 ESTs. Ecotype="Gransden 2004".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGGCGGATGGGCTTTGGGAGAATTGGTGCCTGATGTTGAGGCCGACTCAACTGTGGGACACATTAAGGTTCGGGACTACTGCAAGGATGGCTGGACTATTATCTTCTCTCACCCT
G
GTGCGTGGAATGCGAACCCGGCTGTGAGACCGTATGGGAGCTTCAGATGACAAACTTCATTTGCCTAAGTTTTGCTGTTTACTCATGCATGCCATGACACAATTCCTATGATAAATATC
TGGGTTAGAAACTTACTCGAGATGTTTACTCCTTGGATCAGGTGACTACACACCAGTGTGCACCACGGAATTAGGAAAGATCGCTGCATACAACCCTGAATTTGAGAATCGTGGTGTGAA
GTTGCTAGGACTTTCAACCGATTCCGTTGAGGATCATCTGGGTTGGATTGAGGACATTGAAACTTACACA
GTATGCTTGCAAAACTCTGTATGATTTTTTTTTTCTTGATTTAGAAAATG
TGCTCCTGAAGTAGTAATTGGAGGCAGCTGGTTGGTTAGGTAGAGCCTTTAACGATCAGGGATTAAATCGATCGCAGAGGAAGACTTGAAGTTTTTTCATCGGTTTATGCACATGGAAGT
AGTTTCATACTAAATTTTTGGGTGGAATGTGGATAGCCGGGTGCACCAGTATTGTACCCCATTCTTGCTGACCCTGACCGGAAGATAACAGTGGCCCTCAACATGATGGACCCTGATGAG
AAAGACGCGAACGGAAAGCCACTCGCTTCTCGTGCGTTACACATCGTAGGCCCCGACTGCAGG
GTATGTTTGCTACCTTGTTCTATAATCTTAGGGTAGCTGAGGTTGCTTTCAAACTAG
TTACGAGTAGAACACCTTGATCGTCTCTGAATTGTTGATCCACCATACCAGAATCTTCATCATACTCAAAGCTGCGTTACATCTCTTATTATTTTTATTTTCTCACTTTTGTCTCGATAT
TGGGTCTGTTGTGAGCAGTTGAAGCTGAGTTTCCTGTATCCCGGCACGACCGGCCGCAATTTTGATGAGGTTCTGCGGGTGCTCGATTCATTGCAATTGGCATCCAAGCATAAGATCGCT
ACCCCAGCCAACTGGCAGCCGGGTGAACCCGTTGTCATTTCTCCCTCCGTTTCAAATGAGGAGGCGAAGGAGTTGTTCCCTCAGGGATGGGAGACTTTTAAGTTGCCTTCTGGCCAGCCA
TATCTTCGCATGACATTTGTGGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGGCGGATGGGCTTTGGGAGAATTGGTGCCTGATGTTGAGGCCGACTCAACTGTGGGACACATTAAGGTTCGGGACTACTGCAAGGATGGCTGGACTATTATCTTCTCTCACCCT
G
GTGACTACACACCAGTGTGCACCACGGAATTAGGAAAGATCGCTGCATACAACCCTGAATTTGAGAATCGTGGTGTGAAGTTGCTAGGACTTTCAACCGATTCCGTTGAGGATCATCTG
GGTTGGATTGAGGACATTGAAACTTACACA
CCGGGTGCACCAGTATTGTACCCCATTCTTGCTGACCCTGACCGGAAGATAACAGTGGCCCTCAACATGATGGACCCTGATGAGAAAGAC
GCGAACGGAAAGCCACTCGCTTCTCGTGCGTTACACATCGTAGGCCCCGACTGCAGG
TTGAAGCTGAGTTTCCTGTATCCCGGCACGACCGGCCGCAATTTTGATGAGGTTCTGCGGGTG
CTCGATTCATTGCAATTGGCATCCAAGCATAAGATCGCTACCCCAGCCAACTGGCAGCCGGGTGAACCCGTTGTCATTTCTCCCTCCGTTTCAAATGAGGAGGCGAAGGAGTTGTTCCCT
CAGGGATGGGAGACTTTTAAGTTGCCTTCTGGCCAGCCATATCTTCGCATGACATTTGTGGAATAA

Retrieve as FASTA