Entry information : PpaPrxQ02
Entry ID 6325
Creation 2008-08-08 (Christophe Dunand)
Last sequence changes 2011-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-02 (Christophe Dunand)
Peroxidase information: PpaPrxQ02
Name PpaPrxQ02
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrxQ02
start..stop
S start..stop
PpaPrxQ01 287 1e-99 1..218 1..218
MpPrxQ01 248 2e-84 31..219 30..215
PabPrxQ22 244 1e-82 36..219 37..218
PabPrxQ23 243 2e-82 30..219 31..218
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1873481..1873696 216 N° 2 1873134..1873361 228 N° 3 1872791..1873006 216  
complement(join(1872791..1873006,1873134..1873361,1873481..1873696))


exon

Literature and cross-references PpaPrxQ02
Literature REFERENCE 1 Rensing,S.A. et al., The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants. Science 319 (5859), 64-69 (2008).
REFERENCE 2 Narita,T., Shin-i,T., Tanahashi,T., Nishiyama,T., Suzuki,Y., Sugano ,S., Kohara,Y. and Hasebe,M. Evolution of developmental genes in land plants (Narita). Unpublished (2006)
DNA ref. Phytozome 11:   scaffold_30 (1873696..1872791)
Cluster/Prediction ref. UniGene:   Ppa.19356
Protein sequence: PpaPrxQ02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219
PWM (Da):   %s   23743.3  
PI (pH):   %s   9.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATVTASSLAISASGPAISPHTGRNHCAGHRATSASFMNSELFARSATLSPHAAVVSRPVESRRPSVFTVCKISVGDVVPPIGLKDQDGKLVNLDKFRGKNLVLYFYPADFTPTCTKQACAFRDSYEKFKKAGAEVVGVSADSPELHKQFKARYRLPFTLLSDEGNKLRKDWAVPGDVFGTVPGRITYVIDKNGKVVLIYNNAFDAQKHIDETLNILQS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 6 ESTs. Ecotype="Gransden 2004".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTGTGACCGCTTCTTCTCTAGCGATTTCCGCCTCCGGCCCGGCCATTTCCCCTCACACAGGTCGCAACCATTGTGCAGGGCATCGCGCCACCAGCGCATCGTTTATGAACTCT
GAGCTTTTCGCACGCTCCGCCACTCTGAGCCCTCACGCGGCTGTCGTTTCACGACCTGTCGAGTCTCGCCGTCCCTCGGTCTTCACCGTTTGCAAG
GTACGATGCACGCGCGCGCACTAC
TTCGTGAATTGCCGTTGCCGTTCGAGGTCGTGCCTGTCGATTGCTAATTCGGATGGGTGCCTGTTGATTAATCGTAATTGTAACGCTCGCTGCAGATTTCGGTGGGCGATGTTGTTCCGC
CGATTGGACTGAAGGACCAGGATGGCAAGCTGGTGAATCTAGACAAGTTTAGGGGTAAGAATTTGGTTCTCTACTTCTATCCTGCCGACTTCACTCCTACCTGCACGAAGCAGGCTTGCG
CATTTCGTGATTCGTACGAGAAGTTCAAGAAGGCAGGTGCTGAGGTCGTGGGAGTGAGTGCCGATTCCCCCGAATTGCACAAG
GTAACAGTCTCCTTTTTCCTCCGAAAATGTATATGCC
AATGTCGGCCCACATTGTTTGGTCGAAATTGAATTCAATGCTCACTCAAGGTCGAAGCGTCACTGATTCGGAACCCAACATGGTGTGCAGCAATTCAAGGCGAGGTACAGACTTCCATTC
ACTCTGCTGAGCGACGAGGGCAATAAGCTGCGGAAGGATTGGGCCGTTCCCGGGGACGTCTTCGGAACTGTACCAGGCCGAATCACGTACGTGATCGACAAGAACGGCAAGGTGGTATTG
ATCTACAACAACGCTTTCGATGCCCAGAAGCACATCGACGAGACACTCAATATTCTGCAAAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTGTGACCGCTTCTTCTCTAGCGATTTCCGCCTCCGGCCCGGCCATTTCCCCTCACACAGGTCGCAACCATTGTGCAGGGCATCGCGCCACCAGCGCATCGTTTATGAACTCT
GAGCTTTTCGCACGCTCCGCCACTCTGAGCCCTCACGCGGCTGTCGTTTCACGACCTGTCGAGTCTCGCCGTCCCTCGGTCTTCACCGTTTGCAAG
ATTTCGGTGGGCGATGTTGTTCCG
CCGATTGGACTGAAGGACCAGGATGGCAAGCTGGTGAATCTAGACAAGTTTAGGGGTAAGAATTTGGTTCTCTACTTCTATCCTGCCGACTTCACTCCTACCTGCACGAAGCAGGCTTGC
GCATTTCGTGATTCGTACGAGAAGTTCAAGAAGGCAGGTGCTGAGGTCGTGGGAGTGAGTGCCGATTCCCCCGAATTGCACAAG
CAATTCAAGGCGAGGTACAGACTTCCATTCACTCTG
CTGAGCGACGAGGGCAATAAGCTGCGGAAGGATTGGGCCGTTCCCGGGGACGTCTTCGGAACTGTACCAGGCCGAATCACGTACGTGATCGACAAGAACGGCAAGGTGGTATTGATCTAC
AACAACGCTTTCGATGCCCAGAAGCACATCGACGAGACACTCAATATTCTGCAAAGTTAG

Retrieve as FASTA