Entry information : PpaPrxQ03
Entry ID 6326
Creation 2008-08-08 (Christophe Dunand)
Last sequence changes 2008-08-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: PpaPrxQ03
Name PpaPrxQ03
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrxQ03
start..stop
S start..stop
PabPrxQ23 239 5e-81 31..219 33..218
PpaPrxQ01 239 1e-80 35..219 36..219
MpPrxQ01 237 6e-80 12..219 14..215
KflPrxQ02 237 1e-79 19..218 52..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 663095..663310 216 N° 2 663761..663898 138 N° 3 664190..664279 90 N° 4 664433..664648 216
join(663095..663310,663761..663898,664190..664279,664433..664648)


exon

Literature and cross-references PpaPrxQ03
Literature Rensing,S.A. et al., The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants. Science 319 (5859), 64-69 (2008)
DNA ref. Phytozome 11:   scaffold_233 (663095..664648)
Protein sequence: PpaPrxQ03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219 (198)
PWM (Da):   %s   23373.15 (21413.2)  
PI (pH):   %s   9.84 (9.96) Peptide Signal:   %s   cut: 22 range:22-219
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVSSSLSAVLVPSLVACSSAGLQFSSKSSVNVHSFARGEILGNGLNVSVAAARPQSSAASTRLSSVAPTCKLAVGDPLPPLSLKDQDGREIKLSKFRGRPLILYFYPANETPGCTKQACSFRDSYEDYRKLGATVVGVSGDSPESHKAFKAKYNLPYTLLSDEGNKVRKAFGVPADFFGALAGRQTYVVNRQGIITLIYNNQFQPEKHVPETLKVLQA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 26 ESTs. Ecotype="Gransden 2004".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGTCGTCGTCCCTCTCTGCTGTTCTCGTGCCCTCGCTGGTCGCATGCTCGTCGGCAGGCCTTCAATTTTCCTCCAAATCCAGTGTCAATGTCCATTCCTTCGCCCGAGGTGAG
ATTCTCGGAAACGGGCTAAATGTTTCAGTAGCTGCTGCACGCCCGCAGTCGTCTGCCGCTTCCACTCGGCTCTCGTCTGTCGCTCCTACGTGCAAG
GTGCGAGATAATGCAATGTATCGA
CACTGTTCTCGAGATTGATTCATGTGGTCTGAGTGCTAAGCATAGGTGCCTTCTTGTTAGATAAGAATAGGAGTGGCTATTCTGATTCCGAAGCTATCGTCCACTGTTGAGACTCATGGT
TCTTCTTAATGTAAGTTTAATAAAAATCAATGTTATAGATGTTTGGGGAAGTATTCCTGATCTTGCAACAACCATACACATGGTTTTTGTTTCGTGATGTAGCGTTCTTGTAGCGTCGTA
ACTTGAACTCGTCCGACCATTGGGAGCTTATTATGTGGTTCGATACGAAGACTTGTATATAATGAGTTACTCAGATGGTTCTTAACTTCAGCTGGATGGCTCGCTTTCGTTTTCATAGAC
GAATTTGGTGTGGGGAGGTACGATAACTCGTGGCTGACACTCAGAATTGTCTGCGTTTATGTCCAGCTGGCCGTGGGTGACCCCTTACCTCCACTATCTTTGAAAGACCAAGACGGTCGC
GAGATCAAGCTCTCCAAGTTCAGGGGCCGACCTCTGATTCTGTACTTCTATCCTGCCAACGAGACTCCTGGCTGTACGAAACAG
GTGTTAATTACATTCCTCCGTCTTTTAACTACTAAC
ATTGTCTGCCTGAAACAGTTCCCAGGAAAAGAAGAGAGAACACTATACAGTACATTTTATAAATGCTTCTGAGAGCAAATGCTAAGTCGTTCTTAGTCTTCAAGACTGATTCCTTATGTA
AAGGTAGATGCATGATAAAGTGTACATCTTGATTTCATAAGAATCGGAAATCTTTTTCAGCCTCATTCCAGATACCTGTAGTTTTACTAGTTGATTAGGCTTAACGTTCTTTGCTTGTAT
CGTCAATGCATCCAGGCTTGCTCCTTCCGAGACTCCTATGAGGACTACAGGAAGCTTGGTGCGACCGTTGTCGGAGTTAGCGGAGACTCTCCTGAGTCTCACAAGGTGCGTTTCCTATTT
CTGGACAATCCTCATGGTCATATTTGGTTGAATTTCATAGTTTATCGTCGTGGTAACCATGTTGAAATAATTTTTGTCTTCGGTTTCTCTGACACTTATCAGTACTATGATTCTCATCGC
TAAGTGATTGCGATGCAGGCTTTCAAGGCAAAGTACAACCTCCCTTACACGCTTCTCAGCGATGAAGGCAACAAAGTAAGGAAGGCATTCGGTGTGCCAGCTGATTTCTTCGGCGCTCTG
GCTGGGCGACAAACTTACGTAGTGAACAGGCAGGGGATCATCACCCTGATTTACAACAACCAATTCCAGCCGGAGAAGCATGTCCCGGAGACTCTTAAAGTATTGCAAGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGTCGTCGTCCCTCTCTGCTGTTCTCGTGCCCTCGCTGGTCGCATGCTCGTCGGCAGGCCTTCAATTTTCCTCCAAATCCAGTGTCAATGTCCATTCCTTCGCCCGAGGTGAG
ATTCTCGGAAACGGGCTAAATGTTTCAGTAGCTGCTGCACGCCCGCAGTCGTCTGCCGCTTCCACTCGGCTCTCGTCTGTCGCTCCTACGTGCAAG
CTGGCCGTGGGTGACCCCTTACCT
CCACTATCTTTGAAAGACCAAGACGGTCGCGAGATCAAGCTCTCCAAGTTCAGGGGCCGACCTCTGATTCTGTACTTCTATCCTGCCAACGAGACTCCTGGCTGTACGAAACAG
GCTTGC
TCCTTCCGAGACTCCTATGAGGACTACAGGAAGCTTGGTGCGACCGTTGTCGGAGTTAGCGGAGACTCTCCTGAGTCTCACAAG
GCTTTCAAGGCAAAGTACAACCTCCCTTACACGCTT
CTCAGCGATGAAGGCAACAAAGTAAGGAAGGCATTCGGTGTGCCAGCTGATTTCTTCGGCGCTCTGGCTGGGCGACAAACTTACGTAGTGAACAGGCAGGGGATCATCACCCTGATTTAC
AACAACCAATTCCAGCCGGAGAAGCATGTCCCGGAGACTCTTAAAGTATTGCAAGCTTAG

Retrieve as FASTA