Entry information : NcNOx01
Entry ID 6349
Creation 2008-09-18 (Christophe Dunand)
Last sequence changes 2008-09-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Catherine Mathe (Scipio))
Peroxidase information: NcNOx01
Name NcNOx01
Class Ancestral NADPH oxidase    [Orthogroup: NOx002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcNOx01
start..stop
S start..stop
EfeNOx 997 0 6..553 10..557
GzNOx01 986 0 1..553 5..557
MgrNOx01 962 0 1..553 1..553
CpurNOx01 956 0 6..553 10..557
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1254936..1255036 101 N° 2 1255122..1255376 255 N° 3 1255434..1256662 1229 N° 4 1256756..1256832 77
join(1254936..1255036,1255122..1255376,1255434..1256662,1256756..1256832)


exon

Literature and cross-references NcNOx01
Literature Galagan J.E. et al., The genome sequence of the filamentous fungus Neurospora crassa. Nature 422:859-868(2003).
Protein ref. UniProtKB:   Q7RW00
DNA ref. JGI genome:   supercont10.1 (1254936..1256832)
Protein sequence: NcNOx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   553
PWM (Da):   %s   63872.82 Transmb domain:   %s   i16-38o53-75i101-123o138-160i173-195o
PI (pH):   %s   9.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLLVLLKKQLTPTKLLFHVLFWTFHWGIFAYGWWKQASDARLAGLNKLQYSVWFSRGAGLVLSVDAMLILLPVCRTIMRFIRPKIRFIPLDENIWMHRQLAYAMLLFTVIHTASHYVNFYNVEKTQIRPVSAVQIHYAQPGGITGHVMLLCMLLMYTTAHHRIRQQSFETFWYTHHLFIPFFLALYTHTVGCFVRDTASSFSPFDGKQYWEHCIGYLGWRWELWTGGFYLLERLYREIRAIRETKITRVVRHPYDVVEIQFHKPSFKYKAGQWLFLQMPQVSKYQWHPFTITSCPYDPYVSVHIRQVGDFTRELANSIGAGPAQAKLYDGVDPNGMYEVALMNGDHLPPLRIDGPYGAPAEDVFENEIAVLIGTGIGVTPWASILKNIWHLRNGPNPPTRLRRVEFIWVCKDTSSFEWFQILLSSLEQQSSEAARIPGSSGIEFLKIHTYLTQKLDMDTTQNIVLNSVGAEVDPLTELKARTNFGRPNFQRFFESMRNGILDRTYLNGLEGNMRTTVGVYFCGPSAARDIQKAAKTATTREVNFRFWKEHF

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo I, 3 introns). Strain="ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCTCCTCGTACTGCTGAAGAAGCAGCTTACGCCAACTAAGCTGCTTTTCCATGTTCTCTTCTGGACATTTCACTGGGGAATCTTTGCTTATGGATGGTACGTTTTCATCTTGTCA
GCTGGTGGTAGATTGGGCTTGGGACTTGGTGAGCAAAGGCAAAGTTGCTGACACGACAATCAACAGGTGGAAGCAAGCATCTGATGCCCGCCTAGCGGGTCTTAACAAATTACAGTACTC
AGTCTGGTTCTCTCGAGGTGCCGGTCTAGTGTTGAGTGTAGATGCCATGCTCATCTTGTTGCCAGTCTGCAGAACGATCATGAGGTTCATCCGACCCAAGATTAGATTCATCCCACTTGA
TGAGAATATCTGGATGCATAGACAGCTTGCTTACGCTATGCTTCTCTTTACCGTCATCCACACCGCATCTCATTACGTCAA
GTGAGTATCGGCCACAAAACATAGGGAGATACCAAGACA
CTGCTAACCTGACAACAGCTTCTACAACGTTGAAAAGACACAGATCCGACCCGTATCGGCAGTCCAGATTCACTACGCCCAGCCTGGCGGTATCACCGGCCATGTCATGCTCCTTTGTAT
GCTTCTGATGTACACGACAGCCCACCACCGCATCAGACAGCAATCCTTCGAGACCTTTTGGTACACTCACCACCTCTTCATCCCCTTCTTCCTCGCCCTGTACACCCACACAGTTGGCTG
CTTCGTCCGCGACACTGCCAGCAGCTTCTCGCCCTTTGACGGTAAGCAGTACTGGGAGCACTGCATCGGCTACCTCGGCTGGCGCTGGGAGCTTTGGACAGGCGGCTTTTACCTCCTCGA
GCGCCTGTATCGCGAAATCCGTGCTATTCGTGAAACCAAGATTACCCGTGTGGTCCGCCACCCTTACGATGTTGTCGAGATCCAGTTTCACAAGCCCTCATTCAAGTACAAGGCCGGCCA
GTGGCTCTTTTTGCAGATGCCCCAAGTCTCCAAGTACCAATGGCACCCCTTCACCATCACGTCGTGCCCGTACGATCCTTATGTCTCCGTGCATATCCGCCAAGTCGGTGACTTCACCAG
GGAACTCGCCAATTCCATCGGCGCCGGCCCCGCCCAAGCTAAGCTCTACGACGGCGTCGACCCCAATGGCATGTACGAGGTCGCCCTTATGAACGGCGACCACCTTCCCCCTCTCCGCAT
CGACGGACCCTATGGTGCGCCCGCCGAAGACGTCTTTGAGAACGAGATCGCCGTGCTGATCGGTACGGGTATTGGCGTCACCCCCTGGGCCTCCATCCTCAAGAACATCTGGCATCTGCG
CAACGGGCCAAACCCGCCTACCCGTCTGCGCCGTGTCGAGTTCATCTGGGTGTGCAAAGATACCTCTTCGTTCGAGTGGTTCCAGATTTTGCTGAGTTCGCTGGAGCAGCAGTCGAGCGA
GGCGGCCCGGATCCCCGGATCAAGCGGAATAGAGTTCCTCAAGATTCATACGTACCTCACGCAGAAGCTGGACATGGATACCACGCAGAATATCGTGCTGAATAGTGTCGGTGCCGAAGT
GGATCCCCTGACGGAGCTCAAGGCGAGGACGAATTTTGGTCGGCCCAACTTCCAAAGGTTCTTTGAGAGCATGCGGAATGGTATTTTGGATCGGACGTATTTGAATGGGTTGGAGGGCAA
TATGCGGACGACGGTCGGAGTGTATTTCTGCGGGCCTAGTGCTGCTG
GTGAGTTCTTCCTTCCTGCCCCCCCAAAAAACCATTTAGTGATTGTTAGGGATTTGCTTACTGACATGTTTTT
TTTTTTTTTTTTTCGAACAGCCCGTGATATCCAAAAGGCGGCCAAGACGGCGACGACTCGTGAGGTCAATTTTAGGTTCTGGAAGGAACACTTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCTCCTCGTACTGCTGAAGAAGCAGCTTACGCCAACTAAGCTGCTTTTCCATGTTCTCTTCTGGACATTTCACTGGGGAATCTTTGCTTATGGATGGTGGAAGCAAGCATCTGAT
GCCCGCCTAGCGGGTCTTAACAAATTACAGTACTCAGTCTGGTTCTCTCGAGGTGCCGGTCTAGTGTTGAGTGTAGATGCCATGCTCATCTTGTTGCCAGTCTGCAGAACGATCATGAGG
TTCATCCGACCCAAGATTAGATTCATCCCACTTGATGAGAATATCTGGATGCATAGACAGCTTGCTTACGCTATGCTTCTCTTTACCGTCATCCACACCGCATCTCATTACGTCAA
CTTC
TACAACGTTGAAAAGACACAGATCCGACCCGTATCGGCAGTCCAGATTCACTACGCCCAGCCTGGCGGTATCACCGGCCATGTCATGCTCCTTTGTATGCTTCTGATGTACACGACAGCC
CACCACCGCATCAGACAGCAATCCTTCGAGACCTTTTGGTACACTCACCACCTCTTCATCCCCTTCTTCCTCGCCCTGTACACCCACACAGTTGGCTGCTTCGTCCGCGACACTGCCAGC
AGCTTCTCGCCCTTTGACGGTAAGCAGTACTGGGAGCACTGCATCGGCTACCTCGGCTGGCGCTGGGAGCTTTGGACAGGCGGCTTTTACCTCCTCGAGCGCCTGTATCGCGAAATCCGT
GCTATTCGTGAAACCAAGATTACCCGTGTGGTCCGCCACCCTTACGATGTTGTCGAGATCCAGTTTCACAAGCCCTCATTCAAGTACAAGGCCGGCCAGTGGCTCTTTTTGCAGATGCCC
CAAGTCTCCAAGTACCAATGGCACCCCTTCACCATCACGTCGTGCCCGTACGATCCTTATGTCTCCGTGCATATCCGCCAAGTCGGTGACTTCACCAGGGAACTCGCCAATTCCATCGGC
GCCGGCCCCGCCCAAGCTAAGCTCTACGACGGCGTCGACCCCAATGGCATGTACGAGGTCGCCCTTATGAACGGCGACCACCTTCCCCCTCTCCGCATCGACGGACCCTATGGTGCGCCC
GCCGAAGACGTCTTTGAGAACGAGATCGCCGTGCTGATCGGTACGGGTATTGGCGTCACCCCCTGGGCCTCCATCCTCAAGAACATCTGGCATCTGCGCAACGGGCCAAACCCGCCTACC
CGTCTGCGCCGTGTCGAGTTCATCTGGGTGTGCAAAGATACCTCTTCGTTCGAGTGGTTCCAGATTTTGCTGAGTTCGCTGGAGCAGCAGTCGAGCGAGGCGGCCCGGATCCCCGGATCA
AGCGGAATAGAGTTCCTCAAGATTCATACGTACCTCACGCAGAAGCTGGACATGGATACCACGCAGAATATCGTGCTGAATAGTGTCGGTGCCGAAGTGGATCCCCTGACGGAGCTCAAG
GCGAGGACGAATTTTGGTCGGCCCAACTTCCAAAGGTTCTTTGAGAGCATGCGGAATGGTATTTTGGATCGGACGTATTTGAATGGGTTGGAGGGCAATATGCGGACGACGGTCGGAGTG
TATTTCTGCGGGCCTAGTGCTGCTG
CCCGTGATATCCAAAAGGCGGCCAAGACGGCGACGACTCGTGAGGTCAATTTTAGGTTCTGGAAGGAACACTTTTAA

Retrieve as FASTA