Entry information : ZmAPx03 (APx3 / GRMZM2G004211 [6a])
Entry ID 6379
Creation 2008-10-03 (Christophe Dunand)
Last sequence changes 2011-01-21 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-07-01 (Christophe Dunand)
Peroxidase information: ZmAPx03 (APx3 / GRMZM2G004211 [6a])
Name (synonym) ZmAPx03 (APx3 / GRMZM2G004211 [6a])
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Meristems
Ovaries
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx03
start..stop
S start..stop
SbAPx03 516 0 1..290 1..290
SiAPx10 495 1e-179 2..289 4..291
OsAPx03 480 1e-173 2..289 3..290
BdiAPx06 460 1e-165 3..289 5..293
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 101007097..101007209 113 N° 2 101006887..101007011 125 N° 3 101006718..101006767 50 N° 4 101006577..101006642 66
N° 5 101006464..101006512 49 N° 6 101006238..101006320 83 N° 7 101006049..101006128 80 N° 8 101005811..101005913 103
N° 9 101005464..101005667 204  
complement(join(101005464..101005667,101005811..101005913,101006049..101006128,1 01006238..101006320,101006464..101006512,101006577..101006642,101006718..1010067 67,101006887..101007011,101007097..101007209))


exon

Literature and cross-references ZmAPx03 (APx3 / GRMZM2G004211 [6a])
Protein ref. UniProtKB:   B6T684
EST ref. GenBank:   DR972292.1 [5' end]   CF625763.1 [3' end]
Cluster/Prediction ref. UniGene:   Zm.28302
Protein sequence: ZmAPx03 (APx3 / GRMZM2G004211 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   290
PWM (Da):   %s   31939.32 Transmb domain:   %s   o261-283i
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAPLVDAEYMAEIERARRDLRALVASKNCAPIMLRLAWHDAGTYDAKTNTGGPNGSIRFPQEYSHSSNAGIKIAIDLEPVKQKHPKITYADLYLAGVVAVEVTGGPTVDFVPGRKDSSICPEEGRLPDARRGASHLRQVFYRMGLSDRDIVALSGGHTGRAHRERTGFDGPWTRDPLKFDNSYFLELLKGDSEGLLKLPTDKVLVEDPEFRQHVQLYADEDAFFRDYAESHKKLSELGFTPPRSCLSSRSANKHKSLLVQAAAGLAVATAVVAWAYLCESNNKFI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, 9 introns) and 6 ESTs. Incorrect prediction from Phytozome due to a probable sequencing error. ACC CCC CC(C)T CGC TCT, (c) has been removed from the genomic sequence to remove the frame shift.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCACCCCTGGTGGACGCCGAGTACATGGCCGAGATCGAGAGGGCACGGCGGGACCTCCGCGCTCTCGTCGCCAGCAAGAACTGCGCGCCGATCATGCTCCGCCTCGCGTACGTC
CTCCTCATGAATCGCAATCAATGGCGCGCGGTGCCGAGCGAGCGACCAACAATGGCTCCTTTTCCACGTTGCATGCAGGTGGCACGACGCCGGCACTTACGACGCCAAGACCAACACAGG
AGGCCCCAACGGCTCCATAAGGTTCCCACAGGAGTACAGCCACTCTTCAAACGCAGGGATCAAGATCGCCATTGACCTCTTAG
GTCAGTTTGTTTGTTTTTTTTCCCTAGTCCCCCAGTG
CGCAAGCTAAGCTTTCGAAACGTCTCTCCATCGAGCGGACGATCAAGTCTTTTGCGTTGACAGTCTGCTTCCTGCTGCGCAGAGCCTGTGAAGCAGAAGCACCCCAAGATCACATACGCA
GACCTGTATCAG
GTAGTGGTAGTACAGCTATTTACCCAATCCATACGTACTGTACCATGGTTCATTGTGGTGCGTTTCATCGACCAGCTCGCCGGAGTTGTCGCCGTCGAAGTCACTGGT
GGACCGACCGTTGACTTCGTCCCTGGGAGGAAG
GTGAGTTAGTACTACAAGTGGCAGCCTCAGATTCATCATTACTGACACAACTGCTCGTCACCAGGATTCTTCGATTTGTCCAGAGGA
AGGACGCTTGCCGGATGCTAGAAGAG
GTTTGCTTCGCAGCACATCATCTTTACAAGTTTCTTCTTTTTTATATATGAAAACACATACAGCAATCGGTATACGCAACAGAGTTCTTCTGCA
TTACTGAACCAGCTTCTAATTCTCCTCTCTCTCTCTCTCTCTCTTGAAGGTGCTTCGCATCTCAGACAAGTATTCTACCGGATGGGTTTATCAGACAGGGACATTGTGGCGCTCTCCGGC
GGCCATACTCTG
GTACGCAAGAACACCTTTTCTTGTTCATGCATATTACAGCATGATCTCAATCAGATCAACGTGGTGGTTTGGTTCCATTTTATCCGAAATCCGCAATACGAATTTTCA
GGGGAGAGCGCATCGAGAGAGGACAGGGTTTGATGGCCCATGGACTAGGGATCCTCTGAAATTTGACAACTCTTATTTCCTGTAAGCCTTGTGTCGACGAGCATGGCACACAGTTGTTGC
CTTTATTTTTCTTTCCTCAGATTATTTATGGTTAGTAATACCACAGCACCCTGCTTGTGTCTTATCGCTTCACATCCTATCCTATCTATGATGCAGTGAGCTTCTGAAAGGCGACTCTGA
AGGGCTCTTGAAACTCCCTACTGACAAGGTTCTTGTGGAAGATCCTGAATTCCGTCAGCATGTCCAACTATATGCCAAG
GTACACTCATTCATTGCTTGGTGTCAGTCAAAACAAAAGAA
CAGTTCATTCATTGCTTGGTGTCAGTCAGTGCTGGCCTACCTCATTTGTATAGCGTCAGTGAGTCGACACTCACACTGATCATTTTGTCAACTTTGTCGCAGGATGAAGATGCATTTTTC
AGGGACTACGCGGAGTCACACAAGAAGCTGTCAGAGCTAGGCTTCACCCCCCCTCGCTCTTGTCTCTCATCCAGATCTGCGAATAAACACAAGTCGTTGCTGGTGCAAGCTGCAGCTGGG
CTCGCAGTTGCTACCGCAGTTGTCGCATGGGCGTACCTGTGCGAATCCAACAACAAGTTCATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCACCCCTGGTGGACGCCGAGTACATGGCCGAGATCGAGAGGGCACGGCGGGACCTCCGCGCTCTCGTCGCCAGCAAGAACTGCGCGCCGATCATGCTCCGCCTCGCGTGGCAC
GACGCCGGCACTTACGACGCCAAGACCAACACAGGAGGCCCCAACGGCTCCATAAGGTTCCCACAGGAGTACAGCCACTCTTCAAACGCAGGGATCAAGATCGCCATTGACCTCTTAG
AG
CCTGTGAAGCAGAAGCACCCCAAGATCACATACGCAGACCTGTATCAG
CTCGCCGGAGTTGTCGCCGTCGAAGTCACTGGTGGACCGACCGTTGACTTCGTCCCTGGGAGGAAGGATTCT
TCGATTTGTCCAGAGGAAGGACGCTTGCCGGATGCTAGAAGAG
GTGCTTCGCATCTCAGACAAGTATTCTACCGGATGGGTTTATCAGACAGGGACATTGTGGCGCTCTCCGGCGGCCAT
ACTCTG
GGGAGAGCGCATCGAGAGAGGACAGGGTTTGATGGCCCATGGACTAGGGATCCTCTGAAATTTGACAACTCTTATTTCCTTGAGCTTCTGAAAGGCGACTCTGAAGGGCTCTTG
AAACTCCCTACTGACAAGGTTCTTGTGGAAGATCCTGAATTCCGTCAGCATGTCCAACTATATGCCAAG
GATGAAGATGCATTTTTCAGGGACTACGCGGAGTCACACAAGAAGCTGTCA
GAGCTAGGCTTCACCCCCCCTCGCTCTTGTCTCTCATCCAGATCTGCGAATAAACACAAGTCGTTGCTGGTGCAAGCTGCAGCTGGGCTCGCAGTTGCTACCGCAGTTGTCGCATGGGCG
TACCTGTGCGAATCCAACAACAAGTTCATCTAA

Retrieve as FASTA