Entry information : SbPrx61 (Sobic.003G152000.1 [2.1] / Sb03g013200 [1.4])
Entry ID 6388
Creation 2008-10-16 (Christophe Dunand)
Last sequence changes 2011-01-24 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx61 (Sobic.003G152000.1 [2.1] / Sb03g013200 [1.4])
Name (synonym) SbPrx61 (Sobic.003G152000.1 [2.1] / Sb03g013200 [1.4])
Class Class III peroxidase    [Orthogroup: Prx099]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx61
start..stop
S start..stop
ZmPrx101 630 0 1..364 1..368
SofPrx06 625 0 1..364 1..372
SiPrx01 589 0 1..339 1..339
BdiPrx63 545 0 29..364 17..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16164482..16164736 255 N° 2 16167208..16167633 426 N° 3 16167749..16168162 414  
join(16164482..16164736,16167208..16167633,16167749..16168162)


exon

Literature and cross-references SbPrx61 (Sobic.003G152000.1 [2.1] / Sb03g013200 [1.4])
Literature JGI
DNA ref. Phytozome 12:   chromosome_3 (16164542..16168162)
Protein sequence: SbPrx61 (Sobic.003G152000.1 [2.1] / Sb03g013200 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   918
PWM (Da):   %s   104938.7 Transmb domain:   %s   i13-35o
PI (pH):   %s   9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPAASKGGRMGGGAVAAAAMAAAAVLLCLQLPAVARGQLQVGFYNTSCPNAESLVQQAVASAFANDSGIAAGLIRLHFHDCFVRGCDASVLLTSPNNTAERDAPPNNPSLRGFQVIDAAKAAVEQSCPQTVSCADIVAFAARDSINLTGNLAYQVPSGRRDGNVSLLSDANTNLPAPTFNASQLVAGFAAKNLTDEEMVILSGAHTVGRSFCTAFLPRIYNGSTPIVDTGLSAGYATLLQALCPSNANSSTPTTTVIDPSTPAVLDNNYYKLLPLNMGLFFSDNQLRVNSTLNASVNSFAANETLWKEKFVAAMIKMGNIEVLTGSQGEIRLNCSVVNNGSSSSSSSVGIQQTTASLDEIATS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, introns 1 and 3'). No EST. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCGGCTGCAAGCAAGGGAGGAAGAATGGGCGGTGGTGCGGTGGCGGCAGCGGCCATGGCGGCCGCCGCTGTGCTGCTGTGCCTCCAGCTGCCGGCGGTGGCCCGTGGCCAGCTG
CAGGTGGGGTTCTACAACACGAGCTGCCCCAACGCTGAGTCCCTGGTCCAGCAGGCCGTGGCCAGCGCTTTCGCCAACGACTCCGGCATCGCCGCCGGCCTCATCCGCCTCCATTTCCAC
GACTGCTTCGTCAGG
GTACGTATACATACGACATGGATGCTGGCCGCCATCCGTCCCCTTGGATTTGGATTTGGATTTTTTCTGTTTCTTCCCTGCTTGCTTGCCTTAATCTCGATCTAG
CTTCTGCACAATAATGACGACCGATTCTTTATCAACTAACCTTGCTAGCATGTTGGATTAACTCGCTAATAGAGTCTATCGTTGAATGCATGTTTCCATTCCTTTTTTTAATGGTTAACT
ACTCTAACAGTCCAGGGAGTACAAGATAAGGGAATTAGGTAGCAATTACACATTAATATTGGCCTTGTTTTGCGGCCCATTTGTATATGGTCATATGGACGGAATAAAGAGTTGAGTTAG
TCGACAGTCACATATGCCTTGCTTCCATGCATGATGCCATCCTAACTGGTTCTTCACCTAATCACCTTTTGTTTTCTTTTGTCGGTTTCCCCTCTTTTGGAGATATGGACAACACCTCAT
GGACTTGTGATTTTCCAAGTAACAGTAGTTGGAAAATGTTGTATGTATTTTTTATAAATCGAGTCAAAGTTATTGAAATCCAAATCATGGCGACAAATATTTAGAAATAAAGAGAGTAGT
TTATAATCTCTCTGTTCCATAATAGATAACGTTACATGATACATGTTGATCAAATTTCCTCAACTTTAATTAAATTTATTAAAATTATGTGCAATACTTATAGTCCATAGGCCATAGCTG
CTAGCTTTAACCCATCATCTCCAGTTTCTCTTGCATGGCTAGAAAGCTCCAAATAATAATAAAAAAGAGCAAAAGTTCACATACAGTACATACATACATGTATATGAATTGTCAAACAAA
GTAACGAACCATCAAGATCGACGTGAAAAAAGTAAAGGAGATAGCTCCGTTACTCCGTACCGTCGTTCGTCTCTCTGTCTCTGTCCCTCTGCTGCAGATCGAACAGCTTTTTCGTAGTCC
ACACAGATGCAGATGAGCACGGCACCACGTGCATCTTCTTCCTCGTGGACAGACTTGTGGTCATCGCTGGCCACTGTAGCCACACTGTCGTAGTACGTCCTCTGGGTGGGAGAACATTCA
GAAAAAGCATCTGCTGTGATTGATGTTCCTTCTTGGAACAACGACACAAACAGCGGTAAAAGATCCACTGTGACTTTTTTTTGTTAAATGGCAAGAATTATTACCACAGCACACATAACA
TGATTATCGAGCAACTTGGAGTTCTTTTAATTGCACAATAACGACGACCGATTATCACTTGACCTCTAGCTATTAGCATCGGATTATTAACTAAGGCCTTGTTTAGTTCACCCTGAAAAC
CAAAAAGTTTTCAAGATTCCCTGTCACATCGAATCTTGTAGCACATACATGAAACATTAAATATAAACGAAAACAAAAACTAATTACACAGTTTAGCTGTAAATCACGAGCCGAATCTTT
TGATCCTAGTGAGTCCATGATTGGATAATATTTATCACAAACAAACGAAAGTGCTACAGTACCGAAAATTTTTCACTTTTCGGAACTAAACAAGGCCTAAGTAATATATAGTAGATTCTG
CAGTTCAATGTTTCCAAATTTTTGTTACGGCTAATTACTCCAGCAAGTACTATAGCTAAGGGAATTAGCTAGCAATTGTATGCACGATAATAATATTCAAGTATTTTGGCATGCTTTTGC
AGTTGCATATGGACGGAATAAAGGGTTCAGTTTTAGTTGACAGCCACATATGTCTTGCTTCCATCCTAACTGGTGCTTCCTTCACCTTTTGGTTTCTTTGGTTAGTTTCCCTTCTTTTAA
TTAGGAGATGTGGACAACACTTCAGAGACTTAGAGACTTTTGTGCTTCAAGTAGTATCGCAAAGAAAAAAATAGTAGTAGCTAAAATACAACTCATCATCGAAGATGTAAATACTCACCG
ACGATGCATGCAGTCCAAGAGAGATGTCATGCATATAGCACACCTACATAGCGAACTCATCATCATCTCCGTTGTCCTTACATGGCTAATATAGTATAGCTGGAAATTAGCTCAGCGAAA
GTTGTTCCCCCATAATACTAACGTCCATGTACCCTTGTCAGGCCTTGTTTCCGATCGAACAGCCTTTTCAATGCAAGTCACAGAGATGCGGATGACCATGCACCACGTGCATGTGTTCTT
CCTTCCCTTGTGGTCAGTGGTCGCCGGCCGCTCGCCACCGTAGTCACACTGTCGTAGGTGGAACATTCAGAAAAAGCATCCGCTGTTTATGTTCAAACAAGTATTACCACACCACACATG
GTATTATTATCCTCCAATGCAATTTCTAAAATAACCTGGAAACTTTTACACATATATTAACACTGCATTAATTACTGCAACAGCAGGGAATGAGAAAGAAATTCACTACAGTATATATAT
CTTGAGATCATCTACCTACTCTACTTGTGTGATTTTGATTTTGCAAACGGCCGGGATGTTGATGGTGCACAAATATATAATATCAGGGCTGTGACGCGTCGGTGCTGCTGACCTCCCCGA
ACAACACGGCGGAGCGCGACGCGCCGCCCAACAACCCGAGCCTCCGCGGGTTCCAGGTGATCGACGCGGCCAAGGCGGCGGTGGAGCAGAGCTGCCCGCAGACGGTGTCGTGCGCGGACA
TCGTGGCGTTCGCGGCGCGCGACAGCATCAACCTCACGGGCAACCTCGCGTACCAGGTGCCCTCGGGCCGCCGCGACGGCAACGTCTCCCTCCTCTCCGACGCCAACACCAACCTCCCCG
CGCCGACGTTCAACGCGTCCCAGCTGGTGGCCGGCTTCGCGGCCAAGAACCTCACCGACGAGGAGATGGTCATCCTCTCCGGCGCACACACCGTCGGACGCTCCTTCTGCACCGCATTCC
TCCCGCGCATCTACAACGGATCCACCCCGATC
GTACGTAATTAACATATGATGATGATGATATATATATACTAATAATAACAATTGACGTCTGATGATGCAAAATAATAATTCCTCGATC
TGCATGCCATGCAATATTATATTTCAGGTTGACACGGGGCTGAGCGCAGGGTACGCCACGCTGCTGCAAGCGCTGTGCCCGTCCAACGCCAACTCGTCGACGCCGACGACGACGGTGATC
GACCCGAGCACGCCGGCGGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTCAACATGGGCCTCTTCTTCTCCGACAACCAGCTGCGGGTCAACTCCACGCTCAACGCCTCCGTCAAC
AGCTTCGCGGCCAACGAGACGCTCTGGAAGGAGAAGTTCGTCGCCGCCATGATCAAGATGGGGAACATCGAGGTGCTCACGGGGAGCCAGGGAGAGATCAGGCTCAACTGCAGCGTCGTC
AACAACGGCTCCTCGTCGTCGTCGTCGTCGGTGGGGATCCAGCAGACCACCGCGTCCCTCGATGAGATCGCCACGAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCGGCTGCAAGCAAGGGAGGAAGAATGGGCGGTGGTGCGGTGGCGGCAGCGGCCATGGCGGCCGCCGCTGTGCTGCTGTGCCTCCAGCTGCCGGCGGTGGCCCGTGGCCAGCTG
CAGGTGGGGTTCTACAACACGAGCTGCCCCAACGCTGAGTCCCTGGTCCAGCAGGCCGTGGCCAGCGCTTTCGCCAACGACTCCGGCATCGCCGCCGGCCTCATCCGCCTCCATTTCCAC
GACTGCTTCGTCAGG
GGCTGTGACGCGTCGGTGCTGCTGACCTCCCCGAACAACACGGCGGAGCGCGACGCGCCGCCCAACAACCCGAGCCTCCGCGGGTTCCAGGTGATCGACGCGGCC
AAGGCGGCGGTGGAGCAGAGCTGCCCGCAGACGGTGTCGTGCGCGGACATCGTGGCGTTCGCGGCGCGCGACAGCATCAACCTCACGGGCAACCTCGCGTACCAGGTGCCCTCGGGCCGC
CGCGACGGCAACGTCTCCCTCCTCTCCGACGCCAACACCAACCTCCCCGCGCCGACGTTCAACGCGTCCCAGCTGGTGGCCGGCTTCGCGGCCAAGAACCTCACCGACGAGGAGATGGTC
ATCCTCTCCGGCGCACACACCGTCGGACGCTCCTTCTGCACCGCATTCCTCCCGCGCATCTACAACGGATCCACCCCGATC
GTTGACACGGGGCTGAGCGCAGGGTACGCCACGCTGCTG
CAAGCGCTGTGCCCGTCCAACGCCAACTCGTCGACGCCGACGACGACGGTGATCGACCCGAGCACGCCGGCGGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTCAACATGGGCCTC
TTCTTCTCCGACAACCAGCTGCGGGTCAACTCCACGCTCAACGCCTCCGTCAACAGCTTCGCGGCCAACGAGACGCTCTGGAAGGAGAAGTTCGTCGCCGCCATGATCAAGATGGGGAAC
ATCGAGGTGCTCACGGGGAGCCAGGGAGAGATCAGGCTCAACTGCAGCGTCGTCAACAACGGCTCCTCGTCGTCGTCGTCGTCGGTGGGGATCCAGCAGACCACCGCGTCCCTCGATGAG
ATCGCCACGAGCTGA

Retrieve as FASTA