Entry information : ShPrx02 ( SSNCAPEA)
Entry ID 64
Creation 2006-07-13 (Christophe Dunand)
Last sequence changes 2016-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-16 (Achraf Jemmat)
Peroxidase information: ShPrx02 ( SSNCAPEA)
Name (synonym) ShPrx02 ( SSNCAPEA)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Stylosanthes
Organism Stylosanthes humilis (Townsville stylo)    [TaxId: 35628 ]
Cellular localisation N/D
Tissue type N/D
Inducers Colletotrichum inoculation
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value ShPrx02
start..stop
S start..stop
MtPrx06 461 3e-165 5..319 6..325
AhPrx05 460 8e-165 5..319 10..330
GmPrx05 453 5e-162 5..319 7..325
LjPrx07 452 1e-161 1..319 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 888..1280 393 N° 2 1365..1524 160 N° 3 1665..2071 407  
join(888..1280,1365..1524,1665..2071)


exon

Literature and cross-references ShPrx02 ( SSNCAPEA)
Literature Stines,A.P., Curtis,M.D., Aitken,E.A.B. and Manners,J.M. Nucleotide sequence of a pathogen-inducible cationic peroxidase gene (Accession No. L77080) from Stylosanthes humilis. Plant Physiol. 111, 348 (1996). Curtis et al., MPMI (1997).
Protein ref. UniProtKB:   Q41325
DNA ref. GenBank:   L77080.1 (888..2071)
Protein sequence: ShPrx02 ( SSNCAPEA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (296)
PWM (Da):   %s   33645.89 (31258.7)  
PI (pH):   %s   7.45 (7.76) Peptide Signal:   %s   cut: 24 range:24-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MECGFYLVLALVSLGVVNSVVHGQGTRVGFYSSTCPGVESIVRSTVQSHLNSDLTLAAGLLRMHFHDCFVHGCDASLLIDGTNTEKTAPPNIGLRGFEVIDHAKTQLEAACPNVVSCADILALAARDSVVLSGGASWQVPTGRRDGLVSSAFDVKLPGPGDSVDVQKHKFSALGLNTKDLVTLVGGHTIGTTSCQLLSSRLNNFNGTNGPDPTIDPSFLPQLKALCPQDGGASTKRVPLDNGSQTKFDTSYFNNVRRGRGILQSDQALWTDPSTKPFVQSYSLGSTFNVDFGNSMVKMGNIGVKTGSDGEIRKKCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTGTGGTTTCTATCTAGTGTTAGCTTTGGTTTCATTGGGCGTTGTTAACAGCGTAGTGCATGGGCAAGGCACGCGTGTAGGGTTCTACTCCAGTACGTGCCCTGGAGTGGAGTCC
ATTGTTAGGTCGACGGTTCAGTCTCACCTTAACTCTGACCTTACCTTGGCTGCTGGCCTCCTCAGGATGCACTTCCATGACTGCTTTGTTCATGGTTGCGATGCTTCCCTCCTCATTGAT
GGCACCAACACTGAGAAGACTGCGCCACCCAACATTGGACTCAGAGGCTTTGAGGTCATTGATCATGCAAAGACGCAGCTCGAGGCTGCCTGCCCTAATGTTGTGTCTTGTGCTGATATC
CTTGCCCTTGCTGCCCGTGATTCCGTTGTTCTG
GTAACCAACTCTAATTAACTAACTAATAACCGCACTCTGATTAATTATTGTGTGTTAATTCGTGCAAGTATTATGAGAATGCAGAGT
GGTGGAGCTAGTTGGCAAGTGCCAACCGGACGCAGAGATGGGCTAGTGTCAAGTGCCTTCGATGTCAAGTTGCCGGGACCGGGTGATTCTGTTGACGTGCAGAAACACAAGTTTTCGGCA
TTGGGCCTCAACACAAAAGACCTTGTTACCCTTGTTG
GTATATATATTACTTCTCATCACATATCTATTGCATTTTGACTTCCCGTTGACTCAAACTATGGTACTAATATTTAGTAGAAT
CTTTTGAATTAAGTAATTTCTCTTTGGAGCAAACCTTATAATCAAAATATTTTACAGGTGGGCACACCATTGGCACTACAAGTTGTCAGCTTTTGAGCAGCAGGCTAAACAATTTCAACG
GAACAAATGGTCCAGACCCTACCATTGACCCTTCATTTCTTCCTCAGTTAAAGGCTCTTTGCCCTCAGGATGGTGGAGCTTCTACTAAGAGAGTGCCTCTAGATAACGGTAGCCAAACCA
AATTTGATACATCTTACTTTAATAATGTGAGGAGGGGCAGGGGTATTCTGCAATCTGATCAGGCACTTTGGACTGATCCTTCCACAAAGCCATTTGTGCAGAGCTACTCACTTGGATCAA
CCTTTAATGTTGACTTTGGAAATTCTATGGTCAAGATGGGCAACATTGGTGTCAAGACAGGCTCTGATGGTGAAATCCGCAAGAAATGTTCCGCTTTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTGTGGTTTCTATCTAGTGTTAGCTTTGGTTTCATTGGGCGTTGTTAACAGCGTAGTGCATGGGCAAGGCACGCGTGTAGGGTTCTACTCCAGTACGTGCCCTGGAGTGGAGTCC
ATTGTTAGGTCGACGGTTCAGTCTCACCTTAACTCTGACCTTACCTTGGCTGCTGGCCTCCTCAGGATGCACTTCCATGACTGCTTTGTTCATGGTTGCGATGCTTCCCTCCTCATTGAT
GGCACCAACACTGAGAAGACTGCGCCACCCAACATTGGACTCAGAGGCTTTGAGGTCATTGATCATGCAAAGACGCAGCTCGAGGCTGCCTGCCCTAATGTTGTGTCTTGTGCTGATATC
CTTGCCCTTGCTGCCCGTGATTCCGTTGTTCTG
AGTGGTGGAGCTAGTTGGCAAGTGCCAACCGGACGCAGAGATGGGCTAGTGTCAAGTGCCTTCGATGTCAAGTTGCCGGGACCGGGT
GATTCTGTTGACGTGCAGAAACACAAGTTTTCGGCATTGGGCCTCAACACAAAAGACCTTGTTACCCTTGTTG
GTGGGCACACCATTGGCACTACAAGTTGTCAGCTTTTGAGCAGCAGG
CTAAACAATTTCAACGGAACAAATGGTCCAGACCCTACCATTGACCCTTCATTTCTTCCTCAGTTAAAGGCTCTTTGCCCTCAGGATGGTGGAGCTTCTACTAAGAGAGTGCCTCTAGAT
AACGGTAGCCAAACCAAATTTGATACATCTTACTTTAATAATGTGAGGAGGGGCAGGGGTATTCTGCAATCTGATCAGGCACTTTGGACTGATCCTTCCACAAAGCCATTTGTGCAGAGC
TACTCACTTGGATCAACCTTTAATGTTGACTTTGGAAATTCTATGGTCAAGATGGGCAACATTGGTGTCAAGACAGGCTCTGATGGTGAAATCCGCAAGAAATGTTCCGCTTTTAATTAA

Retrieve as FASTA