Entry information : MtPrx100 (Medtr2g437770.1[4.0])
Entry ID 6452
Creation 2009-01-06 (Christophe Dunand)
Last sequence changes 2014-07-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-15 (Christophe Dunand)
Peroxidase information: MtPrx100 (Medtr2g437770.1[4.0])
Name (synonym) MtPrx100 (Medtr2g437770.1[4.0])
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx100
start..stop
S start..stop
GmPrx64 568 0 1..343 1..342
GmPrx181 542 0 1..343 1..345
LjPrx50 542 0 34..343 40..350
PpePrx71 494 3e-177 26..343 30..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14910491..14910775 285 N° 2 14911353..14911695 343 N° 3 14912105..14912508 404  
join(14910491..14910775,14911353..14911695,14912105..14912508)


exon

Literature and cross-references MtPrx100 (Medtr2g437770.1[4.0])
Literature Godiard,L., Niebel,A., Micheli,F., Gouzy,J. and Gamas,P.Identification of potential regulators of the Medicago truncatula - Sinorhizobium meliloti symbiosis with Suppression Subtractive Hybridization libraries.
DNA ref. Phytozome 12:   chr2 (14910491..14912508)
EST ref. GenBank:   AJ846110.1 [Fragment]
Cluster/Prediction ref. Phytozome Gene 12:   31067626
Omic ref. Gene atlas:   Mtr.31380.1.S1_at
Protein sequence: MtPrx100 (Medtr2g437770.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (322)
PWM (Da):   %s   38700.37 (36289.0)  
PI (pH):   %s   5.46 (5.27) Peptide Signal:   %s   cut: 22 range:22-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNSYLRLLFLLVLYIISANSSQPYEENYEDAEFTLQVPTLEDTDLDNLLSFSYYRKSCPQFESILHSKVKEWIKKDYTLAASLLRLHFHDCSVRGCDGSILLNHEGSERKSQVSKTLRGYEIIDDIKAEVEKQCPKTVSCADILTTASRDATVELGGPYWSVPYGRKDGKVSIDKEAEMVPMGHENITSLIEYFQSKGLNVLDLVVLSGAHTIGRTSCGSIQYRLYNYKGTGKPDPSLDTKYLNFLQRKCRWASEYVDLDATTPKKFDRMYYINLEKKMGLLTTDQLLYSDPRTSQLVSALTTSSVFEHQFAVSMSKFGVIDVLTGDDEGEIRTNCNFVNAY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 3) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAATTCTTACCTCCGATTGTTGTTTCTTTTGGTTCTTTACATAATTTCAGCTAATTCATCTCAACCTTATGAAGAAAACTATGAGGATGCTGAGTTCACTCTACAAGTCCCAACA
TTAGAGGATACTGATTTGGATAATCTCTTATCCTTTAGTTACTACCGTAAAAGCTGCCCTCAATTTGAATCCATCTTGCATAGCAAAGTCAAAGAATGGATTAAGAAGGACTATACTTTA
GCAGCTAGTCTCCTAAGGTTGCACTTCCATGATTGTTCTGTTAGG
GTGGGTACATAATATCATTATATCAAGCATTACTCATTATATGTTACATAATAACTGCATTTCTAAAATGTCCGA
TTTTGATCGTCGTGTTTCATGACTCTTTTGCTAAGTCAAAATACGAGTCGTTAGACTAACAATTAAGATTGTTGACTGCATGAATACATGATTATCTCGACTACAAAGAATCCATTATCC
ATTATCCATGTATCTATATGTTTTGCTTGATTTTTCGTGGATTTGGATTTGTATAGTAGTCGAGAACCCCGTAGTCTAGCAATCAATGTTGTCCAATCAAATTACCAAACATGAAGTCTA
GACCATCTACTCTTATAGTGAATGTTTGGATTGTGGTAAGTTTGGTAGAATCACGACGTGTCATACTGTAATTTTGATAAAACTACACTTTAACGTTTCAATTTTCAACAAAATCACGCT
CGTGATTTTGTCATATTCAACATCATTCCAAACACGCACTTAATTTAATGACTCTATATTTGACAATAGAATTCCTAATTTGGAGGAATCCATATCCATTTTTTACTATGTACTTATTTG
AATTTTTTGTTGTACTTTATAGGGATGCGATGGCTCTATTCTATTGAATCATGAAGGAAGTGAAAGGAAATCACAAGTAAGCAAGACATTAAGAGGTTATGAAATTATTGATGATATAAA
GGCAGAAGTAGAGAAACAGTGTCCTAAGACAGTCTCTTGTGCTGACATTCTTACAACTGCTTCAAGGGATGCCACTGTTGAGTTGGGTGGACCATATTGGTCAGTCCCTTATGGAAGGAA
AGATGGGAAAGTCTCTATTGACAAAGAAGCAGAAATGGTACCAATGGGCCATGAGAACATTACTTCCTTGATTGAGTATTTTCAATCCAAAGGCTTGAATGTCCTTGACTTGGTTGTTCT
CTCAG
GTATACAACTTCAATCCATGTATACTTTTTTTGGGAAAAGAAGCTAAAAAAAAGAAAAGAAACAAAAAAACAGCTAAAAACTAGTCTCTGTGATACATCTTTCGTCGGGCATCTG
CATGCAACAGAAGCAAAGCCCTGTCGTTGCTCCAAAAACTCACGCCAAATTTTAGAATTTAGAGCCCCTAGTTTAAACATAAAATCAGCGAACGAATTCACTTCCTTCATAGAATGCTTT
AACTGGACACTCCATTTGATTTATATCTAGTGAGTGAAGTAACATTAGGATTCATTATGAATTTTGGTTGAGAATTGTGGTATATCCTACCTTACATAAAATGTACCTCTCCTAACTAAG
TTATTTATTTATAAAAAATTGTTTAACCAATTTGTTTTCTATATTAATATTCAGGGGCACATACTATTGGAAGGACATCTTGTGGCTCTATTCAATATAGACTATACAACTACAAAGGAA
CAGGCAAACCAGACCCATCATTAGATACAAAATACCTTAACTTCTTGCAAAGAAAATGTAGATGGGCCTCAGAGTATGTAGATCTTGATGCAACAACACCAAAAAAATTTGACCGAATGT
ACTACATAAATCTTGAAAAGAAAATGGGATTGTTAACAACAGATCAATTGTTATATTCTGATCCAAGAACTTCTCAATTGGTTTCAGCATTGACTACATCATCAGTTTTTGAACATCAAT
TTGCTGTTTCAATGTCCAAGTTTGGTGTCATTGATGTTCTTACTGGAGATGATGAAGGAGAAATCAGGACCAATTGCAATTTTGTCAATGCTTATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAATTCTTACCTCCGATTGTTGTTTCTTTTGGTTCTTTACATAATTTCAGCTAATTCATCTCAACCTTATGAAGAAAACTATGAGGATGCTGAGTTCACTCTACAAGTCCCAACA
TTAGAGGATACTGATTTGGATAATCTCTTATCCTTTAGTTACTACCGTAAAAGCTGCCCTCAATTTGAATCCATCTTGCATAGCAAAGTCAAAGAATGGATTAAGAAGGACTATACTTTA
GCAGCTAGTCTCCTAAGGTTGCACTTCCATGATTGTTCTGTTAGG
GGATGCGATGGCTCTATTCTATTGAATCATGAAGGAAGTGAAAGGAAATCACAAGTAAGCAAGACATTAAGAGGT
TATGAAATTATTGATGATATAAAGGCAGAAGTAGAGAAACAGTGTCCTAAGACAGTCTCTTGTGCTGACATTCTTACAACTGCTTCAAGGGATGCCACTGTTGAGTTGGGTGGACCATAT
TGGTCAGTCCCTTATGGAAGGAAAGATGGGAAAGTCTCTATTGACAAAGAAGCAGAAATGGTACCAATGGGCCATGAGAACATTACTTCCTTGATTGAGTATTTTCAATCCAAAGGCTTG
AATGTCCTTGACTTGGTTGTTCTCTCAG
GGGCACATACTATTGGAAGGACATCTTGTGGCTCTATTCAATATAGACTATACAACTACAAAGGAACAGGCAAACCAGACCCATCATTAGAT
ACAAAATACCTTAACTTCTTGCAAAGAAAATGTAGATGGGCCTCAGAGTATGTAGATCTTGATGCAACAACACCAAAAAAATTTGACCGAATGTACTACATAAATCTTGAAAAGAAAATG
GGATTGTTAACAACAGATCAATTGTTATATTCTGATCCAAGAACTTCTCAATTGGTTTCAGCATTGACTACATCATCAGTTTTTGAACATCAATTTGCTGTTTCAATGTCCAAGTTTGGT
GTCATTGATGTTCTTACTGGAGATGATGAAGGAGAAATCAGGACCAATTGCAATTTTGTCAATGCTTATTGA

Retrieve as FASTA