Entry information : BdiPrx80 (Bradi2g37060)
Entry ID 6465
Creation 2009-01-12 (Christophe Dunand)
Last sequence changes 2009-01-12 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: BdiPrx80 (Bradi2g37060)
Name (synonym) BdiPrx80 (Bradi2g37060)
Class Class III peroxidase    [Orthogroup: Prx224]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Callus
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx80
start..stop
S start..stop
BdiPrx79 516 0 1..372 2..351
BdiPrx81 467 2e-166 1..372 1..341
OsiPrx53 381 2e-132 1..372 1..338
TaPrx99-1D 377 1e-130 46..372 22..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37458566..37458835 270 N° 2 37457614..37458462 849  
complement(join(37457614..37458462,37458566..37458835))


exon

Literature and cross-references BdiPrx80 (Bradi2g37060)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr ,D. EST sequencing and phylogenetic analysis of the model grass Brachypodium distachyon. Theor. Appl. Genet. 113 (2), 186-195 (2006).
DNA ref. Phytozome 12:   Bd2 (37458835..37457614)
EST ref. GenBank:   DV471466.1 [5' end]   DV472563.1 [3' end]
Protein sequence: BdiPrx80 (Bradi2g37060)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (346)
PWM (Da):   %s   39373.04 (36806.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.88 (7.50) Peptide Signal:   %s   cut: 27 range:27-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLNSGALVLSLCLLLAFLAGQPAAAGRGDGGKKDGDGGKKGGGDGGKKGGKKDVDVESTVRMIVAKAMEGKPRVGAALVRLLFHDCWVHGCDGSVLLDTVPYGSGSGEKDAENNIGLEGFEVIDDIKAELLRLADGYDNVSCADILVLAARQATAILSRGKIVYAVKRGRMDGVVSSAADADAVLPPSTFKIKQLKDNFKARGFNTRELVALSGAHAVGVAHLSSFVDRLNTATQSPISGAYQNALRSHTEAQKTAQGTNDPIEFNNIRDMDKQFQNAAGYVTTGVDVTANGVLDNSYYKANLQNRVLFRSDWELRNDTDTGANNAGNALDEFGDNAGKWFLAFGQAMAKLSDIPADGPRFEIRKNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1) and 21 ESTs. Cultivar="Bd21". Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCAACTCTGGCGCCCTTGTGTTGTCTCTCTGCCTGCTGCTCGCCTTCTTGGCCGGGCAGCCTGCAGCGGCCGGCAGAGGCGACGGCGGAAAGAAGGACGGCGACGGCGGGAAG
AAAGGCGGCGGTGATGGCGGCAAGAAGGGCGGTAAGAAGGATGTTGACGTGGAGAGCACGGTTAGGATGATAGTGGCCAAGGCCATGGAGGGCAAGCCCCGCGTCGGCGCCGCCCTCGTC
CGGCTGCTCTTCCACGACTGCTGGGTCCAC
GTACGAGATTAATCAAGCCACGCCATCATCTCGATCATAGTATTATAATTTTCTAGTATTAGCACTAATTACTATATGACGTGGATGCAT
GCATGTGTGGCAGGGTTGCGACGGGTCCGTGCTCCTGGACACGGTGCCCTACGGCAGCGGCAGCGGCGAGAAGGACGCCGAGAACAACATCGGCCTCGAAGGCTTCGAGGTGATCGACGA
CATCAAGGCCGAGCTCCTCCGCCTCGCCGATGGCTACGACAACGTCTCCTGCGCCGACATCCTCGTGCTCGCCGCCCGCCAAGCCACCGCCATCCTCAGCCGCGGCAAGATTGTTTACGC
CGTCAAGCGAGGCCGCATGGACGGCGTGGTCTCGTCCGCCGCCGACGCCGACGCCGTGCTTCCACCCTCCACCTTCAAGATCAAGCAGCTCAAGGACAACTTCAAGGCCAGAGGCTTCAA
CACACGGGAGCTCGTAGCTCTCTCCGGCGCGCACGCCGTCGGCGTCGCCCACTTGTCGTCCTTCGTCGACCGCCTCAACACCGCCACGCAGTCCCCGATCAGCGGAGCCTACCAGAACGC
GCTCCGGAGCCACACGGAAGCTCAGAAGACGGCGCAAGGGACGAATGACCCGATCGAGTTCAACAACATCCGTGACATGGACAAGCAGTTCCAGAACGCCGCCGGCTACGTCACCACCGG
GGTGGACGTGACGGCCAACGGCGTCCTGGACAACAGCTACTACAAGGCCAACCTCCAGAACAGGGTGCTCTTCAGGTCCGACTGGGAGCTCCGCAACGACACCGACACGGGCGCGAACAA
CGCCGGGAATGCCCTGGATGAGTTCGGCGACAACGCCGGCAAGTGGTTCCTCGCCTTCGGTCAGGCCATGGCCAAGCTCAGCGACATCCCCGCCGACGGCCCGCGCTTCGAGATCAGGAA
GAACTGCAGAAAGATCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCAACTCTGGCGCCCTTGTGTTGTCTCTCTGCCTGCTGCTCGCCTTCTTGGCCGGGCAGCCTGCAGCGGCCGGCAGAGGCGACGGCGGAAAGAAGGACGGCGACGGCGGGAAG
AAAGGCGGCGGTGATGGCGGCAAGAAGGGCGGTAAGAAGGATGTTGACGTGGAGAGCACGGTTAGGATGATAGTGGCCAAGGCCATGGAGGGCAAGCCCCGCGTCGGCGCCGCCCTCGTC
CGGCTGCTCTTCCACGACTGCTGGGTCCAC
GGTTGCGACGGGTCCGTGCTCCTGGACACGGTGCCCTACGGCAGCGGCAGCGGCGAGAAGGACGCCGAGAACAACATCGGCCTCGAAGGC
TTCGAGGTGATCGACGACATCAAGGCCGAGCTCCTCCGCCTCGCCGATGGCTACGACAACGTCTCCTGCGCCGACATCCTCGTGCTCGCCGCCCGCCAAGCCACCGCCATCCTCAGCCGC
GGCAAGATTGTTTACGCCGTCAAGCGAGGCCGCATGGACGGCGTGGTCTCGTCCGCCGCCGACGCCGACGCCGTGCTTCCACCCTCCACCTTCAAGATCAAGCAGCTCAAGGACAACTTC
AAGGCCAGAGGCTTCAACACACGGGAGCTCGTAGCTCTCTCCGGCGCGCACGCCGTCGGCGTCGCCCACTTGTCGTCCTTCGTCGACCGCCTCAACACCGCCACGCAGTCCCCGATCAGC
GGAGCCTACCAGAACGCGCTCCGGAGCCACACGGAAGCTCAGAAGACGGCGCAAGGGACGAATGACCCGATCGAGTTCAACAACATCCGTGACATGGACAAGCAGTTCCAGAACGCCGCC
GGCTACGTCACCACCGGGGTGGACGTGACGGCCAACGGCGTCCTGGACAACAGCTACTACAAGGCCAACCTCCAGAACAGGGTGCTCTTCAGGTCCGACTGGGAGCTCCGCAACGACACC
GACACGGGCGCGAACAACGCCGGGAATGCCCTGGATGAGTTCGGCGACAACGCCGGCAAGTGGTTCCTCGCCTTCGGTCAGGCCATGGCCAAGCTCAGCGACATCCCCGCCGACGGCCCG
CGCTTCGAGATCAGGAAGAACTGCAGAAAGATCAACTAG

Retrieve as FASTA