Entry information : Zm2CysPrx01 (GRMZM2G139680 [6a])
Entry ID 6475
Creation 2009-01-15 (Christophe Dunand)
Last sequence changes 2009-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-07-08 (Christophe Dunand)
Peroxidase information: Zm2CysPrx01 (GRMZM2G139680 [6a])
Name (synonym) Zm2CysPrx01 (GRMZM2G139680 [6a])
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Endosperm
Meristems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Zm2CysPrx01
start..stop
S start..stop
Sb2CysPrx 510 0 1..260 1..260
Zm2CysPrx02 508 0 1..260 1..260
Ta2CysPrx 433 3e-156 1..260 1..258
Sc2CysPrx 423 3e-152 1..260 1..258
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 110070119..110070307 189 N° 2 110070417..110070491 75 N° 3 110070662..110070743 82 N° 4 110070822..110070901 80
N° 5 110072386..110072511 126 N° 6 110072627..110072740 114 N° 7 110073404..110073520 117  
join(110070119..110070307,110070417..110070491,110070662..110070743,110070822..1 10070901,110072386..110072511,110072627..110072740,110073404..110073520)


exon

Literature and cross-references Zm2CysPrx01 (GRMZM2G139680 [6a])
DNA ref. GenBank:   AC194876.3 (129615..126217)
Cluster/Prediction ref. UniGene:   Zm.118187
Protein sequence: Zm2CysPrx01 (GRMZM2G139680 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   260
PWM (Da):   %s   28141.54  
PI (pH):   %s   5.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSFSAAITVSSAPTPAARPLAAATQSVCIARSAVATTARPLRLAASRSARATRLVARASVVDDLPLVGNKAPDFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTEVLGVSIDSFSHLAWVQTDRKSGGLGDLKYPLVSDVTKSISKAFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGERSMKPDPKGSKEYFAAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 6 introns) and 181 ESTs. Also found in AC200624.4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCCTTCTCCGCCGCCATCACCGTCTCTTCCGCCCCTACCCCGGCCGCCAGACCCCTCGCTGCTGCCACGCAGTCCGTCTGCATCGCTCGCTCCGCGGTCGCCACCACTGCC
AGGCCGCTCCGCCTCGCCGCCTCAAGGTCCGCGCGGGCTACCAGACTCGTTGCCCGCGCCAGCGTAGTC
GTAAGTTCTCCTCGCGTCTTGACTCGCCTTAACGTACTACGGGATTGCTTC
TCACCCCCTCCTAGTTTGCGCACTCACGGCTCGCCCCCTTGTGCCTGTGCTCCGTAAGGATGACTTGCCGCTGGTCGGGAACAAGGCGCCAGACTTCGAAGCCGAGGCTGTGTTCGACCA
GGAGTTCATCAAC
GTAAGTGGACCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCGCGCGCGCGCGCGCAATCTCGCTTGGTTTATGCTGTGGAAGCAGAAATCTAAAATGTTTCATGCGC
TCAAATTGCTCATAATACCCGTTTATGTTACCGGCGATGACATTGTTCTGTGTGCTTTTGCAGGTGAAGCTCTCTGATTACATTGGGAAGAAGTACGTCATTCTGTTCTTCTACCCCTTG
GATTTCACCTTCGTCTGCCCGACCG
GTGAGGATAAAACACTTGCATTAGTATCAAGAAGATTCATTTGTAGTGGTCTGATGAACGAACACATGATGCTTGCAGAGATTACTGCGTTTAGT
GACAGATACGAGGAATTTGAGAAGTTGAACACTGAGGTTCTTGGTGTTTCCATTGACAGTGTG
GTATGAAATAATGCCTTGGTATTCCATGATATGATAGCATCTATCAGTATGAATCAG
TTGTCAATTGTTCTTAAGGATAATGTAGTGTAGTTGTCATCCAATGCCTCTACTGTTTGTAGAGGTGGATGTTCTGTCATATGTCATAGTTACCTCTTGAAGTACATTTCATCAAATGTC
ATAGTTAGCTCTTGATGTACATTTTAGCTTTGATATATACTAACACAAAACGAAAAGAATAATTATGGTTGAACTGCTCCTATAATGAGAATTTTACATGCTACTGCTAGGTTATCTTGT
ATCCATGGTTCTTGAGCATAGTCACATTATTTCTAAAATCAATTCTGGAAAGTATGTTATGTGGAATTAGAAAAAGTAATATACAAATACATAATATTCTATACCAGCTTTACACTTGCC
CGTCTCAATTTTTGGCAAAGTAGTAGGACCACACATGCTGCTTTTTCCTCGCATTGCCAATGTAACTATTAATAGAAAAATCCATCTACATGAACATAATAGCATTATCACTAGGGATGA
AAATGATCAGAAATGGTACATTATAATATGGATTTTGAAAGCGGTTGGTACAAGACTTTCCCTTTTTTTAATAAAAAACTGAAAAACAGTTGTACTAAAATCACAAAACTGACAGCTTCC
ATGTTTTGATAGAACCAGAAATGGAATCATAAACTGATAATGATATCAGTTGATACAGTATTCTCCCATACTGCGTTCACCCCTAAGTGATACATCACTATCCCATATTCATTTTTGTTT
TTAATGTTGGGACTAAACACACTCACATTACACTTGAGGCCTTAAATTCAACCTTTGTTGTCCCAAAGGAAATGTGTTCTAGCTGCATAGTCTTATTAAATTGAACTTTTCTTTTTTCTA
AGGTACATTACAAAGCTTTGGAAAACTGTACTCCCTCCATTTGTAGATATATGATACCATTGACTTTTTACCCAAACTTTGGCCAGCAATATTGTTTAATTACATAGCTCAGTAAAGTGA
AAAGCTAGATCTATTATCAAACTACTAGCCTTGCATGTTTGTCTGTTTGTGCAAATATTTACAGAAAATACAAATACTCAAATGAATGAAAAAGTGTCAAAGGATAAACAGAGGGAGTAG
TATGAAAAATGCCTTAATGACTTATTTGAAGTCTTCTTACAATTATGATTTGTTATTTCTCTCTCAATTCCAAATTATAGGCCATTTTGGCTTTTCTAATATCTAGAAATAGCGTATATC
TAGGTTCATAGCAAAAGCTATTTACCCAGAAAAATCAAAACAACCTATAATTTGGGATGTAGAGAGCTCCTCTTTATATCATTATATGTATGTGGTCAAACGAAGAAACCTTAAACTATA
TAGATAATGGGTTTTGATTACTATTATCTCATTGGTATTATAACTTTTGTTAATTGTTTGTCTTTGTTTGACCATATCTTGACATTCGAATGACTCTTTGGATGCAGTTCTCCCACCTTG
CATGGGTGCAGACAGACAGGAAGTCGGGTGGGCTCGGCGATCTTAAATACCCACTTGTTTCTGATGTGACCAAATCAATTTCAAAGGCCTTTGGTGTTCTGATCCCTGACCAG
GTATTAT
TTGCAGCCACTGGATATTCTTCTCCAGAATCTCCCCCTGTGGAGTCCTTTTGTTTTCCTTGTTATGTTTCTGTTAGTTGCTCTCTAAAGCTCAATGTTCTTTGAGCAGGGTATTGCTTTG
AGAGGACTGTTCATCATTGACAAGGAGGGAGTGATTCAGCACTCTACCATTAACAACCTTGCCATTGGTCGTAGTGTGGATGAGACCATGAGGACCCTTCAG
GTATGTGCTATGTTGGTT
GTGCTACATTTCTGATAGGCGGTTGCTCTGAACTTTAGAAATTATAAGTTTTCTGTGCTGTTACTAAAACATAAAGTAAAAAGAATATGCACTTCTGTGTTCATGGTGTTTGTGATGTAC
AACTTTAACAAGATTCAACAGTGGTGTGCGTTTTACATGATTAATTGTTTGTTACCACTTGACAGTGCAGCGTAGTTCTCCATTTGCAGGAACTAAATGGAGTATTTCCATCCTTTTAAG
CGTACTCTAGTCCAAATGATTCAGAATTACAGAAGAGTTATTGAAAACTATGTTCATTATTTGTGTGACCTCTGCTATGGTATTAGAGTACAAGTACATGCTATAGTACTCCACTATGCT
AAATAACTGCCAAAGAACTATAGATACCACTTTTCAATTTCATAGGGCAAGATGCATCATAGCAAGCATGGTCATACAGAAACAAGTGAGGCTCTTGAAATTATGTAATTTCCAAATGAA
AAAAGCATATTTCTCAGGATGACGATTCTGGTGCAATCATTGGGCATTTTGCTGAGCTGGTCAATGCCCGACCAAGTTACATAGTTGCCTTTGCCATTTTATACAGTCCACAGGTCACAA
TTGGAAGAGTATTGAAGTTGACACCTCATTTCAATGTTTCATCAGGCATTGCAGTACGTCCAGGAGAACCCAGACGAGGTGTGCCCGGCCGGATGGAAACCAGGGGAGAGGTCGATGAAG
CCCGACCCCAAGGGAAGCAAAGAGTACTTCGCGGCCATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCCTTCTCCGCCGCCATCACCGTCTCTTCCGCCCCTACCCCGGCCGCCAGACCCCTCGCTGCTGCCACGCAGTCCGTCTGCATCGCTCGCTCCGCGGTCGCCACCACTGCC
AGGCCGCTCCGCCTCGCCGCCTCAAGGTCCGCGCGGGCTACCAGACTCGTTGCCCGCGCCAGCGTAGTC
GATGACTTGCCGCTGGTCGGGAACAAGGCGCCAGACTTCGAAGCCGAGGCT
GTGTTCGACCAGGAGTTCATCAAC
GTGAAGCTCTCTGATTACATTGGGAAGAAGTACGTCATTCTGTTCTTCTACCCCTTGGATTTCACCTTCGTCTGCCCGACCGAGATTACTGCGTTT
AGTGACAGATACGAGGAATTTGAGAAGTTGAACACTGAGGTTCTTGGTGTTTCCATTGACAGTGTG
TTCTCCCACCTTGCATGGGTGCAGACAGACAGGAAGTCGGGTGGGCTCGGCGAT
CTTAAATACCCACTTGTTTCTGATGTGACCAAATCAATTTCAAAGGCCTTTGGTGTTCTGATCCCTGACCAG
GGTATTGCTTTGAGAGGACTGTTCATCATTGACAAGGAGGGAGTGATT
CAGCACTCTACCATTAACAACCTTGCCATTGGTCGTAGTGTGGATGAGACCATGAGGACCCTTCAG
GCATTGCAGTACGTCCAGGAGAACCCAGACGAGGTGTGCCCGGCCGGATGGAAA
CCAGGGGAGAGGTCGATGAAGCCCGACCCCAAGGGAAGCAAAGAGTACTTCGCGGCCATCTAG

Retrieve as FASTA