Entry information : PinvCcP
Entry ID 6505
Creation 2009-01-20 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PinvCcP
Name PinvCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus involutus    [TaxId: 71150 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PinvCcP
start..stop
S start..stop
PrubCcP01 749 0 1..373 1..373
PadelCcP01 749 0 1..373 1..373
GliviCcP01_BX 697 0 1..371 1..371
HpinCcP 684 0 1..372 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1902..2210 309 N° 2 1793..1841 49 N° 3 1663..1744 82 N° 4 1333..1603 271
N° 5 1191..1273 83 N° 6 1058..1135 78 N° 7 933..1004 72 N° 8 797..880 84
N° 9 649..742 94  
complement(join(649..742,797..880,933..1004,1058..1135,1191..1273,1333..1603,166 3..1744,1793..1841,1902..2210))


exon

Literature and cross-references PinvCcP
Literature Stephen,S.A., Caillau,M., Wright,D.P., Johansson,T., Tunlid,A., Soderstrom,B., Read,D.J. and Scholes,J.D. Transcriptional programmes for nutrient acquisition by the ectomycorrhizal fungus Paxillus involutus.
DNA ref. JGI genome:   scaffold_2209 (2210..649)
EST ref. GenBank:   CD274572.1 [5' end]   CD274423.1 [3' end]
Cluster/Prediction ref. JGI gene:   164804   118698 [5' end]
Protein sequence: PinvCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   41311.55  
PI (pH):   %s   8.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFTAAFRAPVRRTVFSTSCRRAGTEVRANSFRKFSTEVPPPAPKSNTALYAGLGAIAFGGVAYYLYTSSSDTAKEASTAVKSAAQTAKVATKFTPTKADYQKVYNRIAEIIDDASDYDDGSYGPVLLRLAWHASGTYDKNTGTGGSNYATMRFEPEALHGANAGLHVARGLMEKVKKEFDWISYGDLWTLAGVCAVQEMAGPKIPWRPGRIDGFVTHVTPDGRLPDATQGAPHIRIFYRMGFNDQEIVALSGAHALGRCHPDRSGFQGPWTFSPTTFTNDYFKLLFDEKWVWKSWSGPKQLEDKKTKSLMMLPTDYVLTQDKSFKKYAKAYADDNELFFKDFSSAFSRLLELGVPTQQFVASEPWIMGDEA

Retrieve as FASTA  
Remarks Complete sequence from 10 ESTs and genomic (8 introns). Strain="ATCC 200175".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCACTGCAGCTTTCCGTGCGCCCGTACGTAGGACTGTCTTCTCCACTTCGTGCAGGAGAGCAGGCACCGAGGTCAGGGCGAATTCGTTCAGGAAATTCTCGACCGAGGTCCCC
CCTCCTGCTCCCAAGTCAAACACTGCTCTCTATGCCGGACTCGGAGCCATCGCGTTCGGTGGTGTAGCTTACTACCTGTATACCTCTTCTTCCGATACTGCAAAGGAGGCGTCCACAGCT
GTCAAGTCTGCTGCTCAGACCGCGAAGGTTGCTACCAAGTTCACGCCTACCAAGGCCGACTACCAAAAG
GTGCATAGTGTTATCACCCGTGCTTTCCGGAGTATCCCACCAAACTAAAAA
TATCATTAGGTGTACAATCGCATCGCAGAGATTATTGACGACGCTAGTGATTACGATGGTAAAGCCTTTGTCATTCGCTTCGTTCATAGCCGCTCAATGTTCTCAGATGGCTCTTATGGT
CCCGTCCTTCTCCGTCTTGCATGGCACGCCTCTGGCACGTATGATAAGAACACGGGCACGGGCGGAAG
GCACGTCCCATCATTCTCTCCCACGATGATCGTCTTTATGACTAACGTGAAA
TCACCAGCAACTACGCCACGATGCGCTTCGAGCCAGAGGCTCTACACGGCGCCAACGCGGGTCTTCATGTAGCCCGCGGCCTCATGGAAAAGGTCAAGAAGGAGTTTGACTGGATTTCTT
ACGGCGATTTGTGGACTCTTGCTGGTGTTTGTGCCGTCCAGGAGATGGCTGGCCCCAAGATTCCTTGGCGGCCTGGACGTATTGACGGCTTCGTGACCCACGTGACTCCTGATGGGCGTC
TCCCTGATGCGACACAGGGCGCACCACACATTCGGGAT
GTGGGTATCAGGTTGTGGATACTTTGTTCAATAGGTGCTGACAATCCAACCCGTGTCAGATTTTCTACCGTATGGGTTTCAA
TGACCAAGAAATCGTAGCCCTTTCCGGTGCCCATGCTCTTGGTCGCTGCCACCCTGACCG
GTAAGATAGTTCCATAGGCTCCACATGTGTAGGTTTCCAACTCGGCATGATCCAGATCGG
GATTCCAAGGACCCTGGACATTCTCGCCAACGACGTTCACGAACGACTACTTCAAGCTTCTTTTCGATGAGAA
GTACGTCCTCTGGAGTGTCTTGCGCCCATCCGATGCTAACTGGATTA
TCGTAGGTGGGTGTGGAAGAGCTGGAGTGGGCCCAAGCAACTTGAAGATAAGAAGACCAAATCTCTCATGATGCTGCCGTTCGTCTCTTTAAATCCTGACCGAGGCTGAGCTGATGGATG
AGTCCTCCAGAACGGACTACGTTCTTACCCAGGACAAGAGTTTCAAGAAGTATGCCAAGGCCTATGCTGATGACAACGAGCTGTTCTTCAAAGAGTGCGTCCTATCATTTCTTTGGAAAT
GCACAACTCATAACTCATGTCTCCTCAGCTTCTCTTCTGCCTTTTCTAGACTCCTCGAGCTCGGTGTTCCTACTCAACAGTTCGTGGCGTCTGAGCCTTGGATAATGGGTGACGAGGCGT
AG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCACTGCAGCTTTCCGTGCGCCCGTACGTAGGACTGTCTTCTCCACTTCGTGCAGGAGAGCAGGCACCGAGGTCAGGGCGAATTCGTTCAGGAAATTCTCGACCGAGGTCCCC
CCTCCTGCTCCCAAGTCAAACACTGCTCTCTATGCCGGACTCGGAGCCATCGCGTTCGGTGGTGTAGCTTACTACCTGTATACCTCTTCTTCCGATACTGCAAAGGAGGCGTCCACAGCT
GTCAAGTCTGCTGCTCAGACCGCGAAGGTTGCTACCAAGTTCACGCCTACCAAGGCCGACTACCAAAAG
GTGTACAATCGCATCGCAGAGATTATTGACGACGCTAGTGATTACGATGAT
GGCTCTTATGGTCCCGTCCTTCTCCGTCTTGCATGGCACGCCTCTGGCACGTATGATAAGAACACGGGCACGGGCGGAAG
CAACTACGCCACGATGCGCTTCGAGCCAGAGGCTCTACAC
GGCGCCAACGCGGGTCTTCATGTAGCCCGCGGCCTCATGGAAAAGGTCAAGAAGGAGTTTGACTGGATTTCTTACGGCGATTTGTGGACTCTTGCTGGTGTTTGTGCCGTCCAGGAGATG
GCTGGCCCCAAGATTCCTTGGCGGCCTGGACGTATTGACGGCTTCGTGACCCACGTGACTCCTGATGGGCGTCTCCCTGATGCGACACAGGGCGCACCACACATTCGGGAT
ATTTTCTAC
CGTATGGGTTTCAATGACCAAGAAATCGTAGCCCTTTCCGGTGCCCATGCTCTTGGTCGCTGCCACCCTGACCG
ATCGGGATTCCAAGGACCCTGGACATTCTCGCCAACGACGTTCACG
AACGACTACTTCAAGCTTCTTTTCGATGAGAA
GTGGGTGTGGAAGAGCTGGAGTGGGCCCAAGCAACTTGAAGATAAGAAGACCAAATCTCTCATGATGCTGCCAACGGACTACGTTCTT
ACCCAGGACAAGAGTTTCAAGAAGTATGCCAAGGCCTATGCTGATGACAACGAGCTGTTCTTCAAAGA
CTTCTCTTCTGCCTTTTCTAGACTCCTCGAGCTCGGTGTTCCTACTCAACAG
TTCGTGGCGTCTGAGCCTTGGATAATGGGTGACGAGGCGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCCCCACCT CTCTTTCTCC TCCTCCACCA TCATGTCTTT CACTGCAGCT TTCCGTGCGC CCGTACGTAG GACTGTCTTC TCCACTTCGT GCAGGAGAGC AGGCACCGAG GTCAGGGCGA  ATTCGTTCAG GAAATTCTCG ACCGAGGTCC CCCCTCCTGC TCCCAAGTCA AACACTGCTC TCTATGCCGG ACTCGGAGCC ATCGCGTTCG GTGGTGTAGC TTACTACCTG TATACCTCTT  CTTCCGATAC TGCAAAGGAG GCGTCCACAG CTGTCAAGTC TGCTGCTCAG ACCGCGAAGG TTGCTACCAA GTTCACGCCT ACCAAGGCCG ACTACCAAAA GGTGTACAAT CGCATCGCAG  AGATTATTGA CGACGCTAGT GATTACGATG ATGGCTCTTA TGGTCCCGTC CTTCTCCGTC TTGCATGGCA CGCCTCTGGC ACGTATGATA AGAACACGGG CACGGGCGGA AGCAACTACG  CCACGATGCG CTTCGAGCCA GAGGCTCTAC ACGGCGCCAA CGCGGGTCTT CATGTAGCCC GCGGCCTCAT GGAAAAGGTC AAGAAGGAGT TTGACTGGAT TTCTTACGGC GATCTGTGGA 
CTCTTGCCGG TGTCTGTGCC GTCCAGGAGA 

Retrieve as FASTA