Entry information : PinvPrxII
Entry ID 6506
Creation 2009-01-20 (Christophe Dunand)
Last sequence changes 2012-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: PinvPrxII
Name PinvPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus involutus    [TaxId: 71150 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PinvPrxII
start..stop
S start..stop
SlutPrxII01 255 1e-88 5..177 1..172
SbrePrxII01 253 1e-87 5..177 1..172
AthiPrxII 240 2e-82 5..177 1..172
LbiPrxII 239 3e-82 8..177 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 431393..431491 99 N° 2 431555..431570 16 N° 3 431632..431702 71 N° 4 431764..431910 147
N° 5 431963..432100 138 N° 6 432168..432239 72  
join(431393..431491,431555..431570,431632..431702,431764..431910,431963..432100, 432168..432239)


exon

Literature and cross-references PinvPrxII
Literature Stephen,S.A., Caillau,M., Wright,D.P., Johansson,T., Tunlid,A., Soderstrom,B., Read,D.J. and Scholes,J.D. Transcriptional programmes for nutrient acquisition by the ectomycorrhizal fungus Paxillus involutus.
DNA ref. JGI genome:   scaffold_12 (431393..432239)
EST ref. GenBank:   EW972287.1 [5' end]
Cluster/Prediction ref. JGI gene:   11148
Protein sequence: PinvPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181
PWM (Da):   %s   19138.88  
PI (pH):   %s   6.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSDLAGVKLHVGDQLPEGTFRYVPYTPALDDHKACGVPTAFSTKDWAGKKVVLFSVPGAFPTCHVNHLPAYLNKHDQFKAKGVDVIAVLAANDPFVMSGWARAEGVKDEIVALSDINAAWSGPLGLSLDLSHHGFGTRTARYAIIVDDLVVKYIQLEPVGTAVTVSGAEQVLAALDSI*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAGCGATCTTGCCGGTGTCAAGCTTCATGTCGGTGACCAGCTCCCCGAGGGCACCTTCCGCTACGTGCCCTACACTCCTGCCCTTGACGATCATGTGAGTTTCATGGCCATCCGA
TCTTGATCCAGTCACACCGCTCATGCATGACTCTCTGACCAGAAAGCGTGCGGAGTCCGTAAGTATTCTTCTGCTAGCTGATCACCTGAGACCTCATTGCGGGATCTGGAACTTCACAGC
CACCGCATTCTCCACCAAGGATTGGGCTGGCAAGAAAGTAGTTCTGTTTTCTGTTCCTGGAGCATTCACT
GTATGTGATCGATGAGCTATTCCAAGTGATTCGCTATCATGCTAAATTCA
CACCCCGATAGCCTACTTGTCACGTCAACCACCTCCCTGCATACCTCAACAAGCATGACCAGTTCAAAGCAAAAGGCGTCGACGTCATCGCGGTTCTGGCCGCCAACGATCCCTTCGTTA
TGAGCGGATGGGCTCGTGCCGAGGGGGTGAAGGATGAG
GTAACGAATATTGACTACGCCTGCAATGTATCTGTTCTCAAACATCACACAGATCGTTGCTCTCTCCGACATCAACGCGGCA
TGGTCAGGACCACTCGGACTTTCCCTGGACCTGTCGCACCACGGCTTCGGCACTCGCACAGCTCGGTACGCTATCATCGTGGATGACTTGGTCGTCAAATACATCCAG
GTTCGTCTGAAG
TTGACATATTGATTTTTTGGGGAGTCGATGGTCTTACAATGCTTGTGCGCTGCAGCTCGAACCCGTTGGCACCGCCGTCACTGTCTCCGGTGCAGAGCAAGTGCTTGCTGCGCTTGACTC
AATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAGCGATCTTGCCGGTGTCAAGCTTCATGTCGGTGACCAGCTCCCCGAGGGCACCTTCCGCTACGTGCCCTACACTCCTGCCCTTGACGATCATAAAGCGTGCGGAGTCCCCACC
GCATTCTCCACCAAGGATTGGGCTGGCAAGAAAGTAGTTCTGTTTTCTGTTCCTGGAGCATTCACT
CCTACTTGTCACGTCAACCACCTCCCTGCATACCTCAACAAGCATGACCAGTTC
AAAGCAAAAGGCGTCGACGTCATCGCGGTTCTGGCCGCCAACGATCCCTTCGTTATGAGCGGATGGGCTCGTGCCGAGGGGGTGAAGGATGAG
ATCGTTGCTCTCTCCGACATCAACGCG
GCATGGTCAGGACCACTCGGACTTTCCCTGGACCTGTCGCACCACGGCTTCGGCACTCGCACAGCTCGGTACGCTATCATCGTGGATGACTTGGTCGTCAAATACATCCAG
CTCGAACCC
GTTGGCACCGCCGTCACTGTCTCCGGTGCAGAGCAAGTGCTTGCTGCGCTTGACTCAATTTGA

Retrieve as FASTA