Entry information : LbiCcP01
Entry ID 6517
Creation 2009-01-27 (Christophe Dunand)
Last sequence changes 2012-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2009-05-20 (Christophe Dunand)
Peroxidase information: LbiCcP01
Name LbiCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiCcP01
start..stop
S start..stop
LameCcP01 634 0 1..344 1..346
HsubCcP 566 0 1..377 1..379
CcinCcP01 565 0 1..377 1..382
GmarCcP 563 0 1..377 1..383
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 249608..249904 297 N° 2 249962..250010 49 N° 3 250061..250142 82 N° 4 250200..250353 154
N° 5 250408..250524 117 N° 6 250584..250600 17 N° 7 250656..250721 66 N° 8 250786..250935 150
N° 9 250991..251074 84 N° 10 251140..251263 124  
join(249608..249904,249962..250010,250061..250142,250200..250353,250408..250524, 250584..250600,250656..250721,250786..250935,250991..251074,251140..251263)


exon

Literature and cross-references LbiCcP01
DNA ref. JGI genome:   scaffold_12 (249608..251263)
EST ref. GenBank:   EX806203.1 [3' end]
Protein sequence: LbiCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   379
PWM (Da):   %s   42175.24  
PI (pH):   %s   8.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFNALRASLRTAAPLRRAAAGKALPRSSFYRKYSTPPPPAAETPKPKSGNNTTLYLGLAGVAAIGVTYYFIRGEDGAAAVKSIQTKAKFVPTQQDYQKVYNRVAELLDEAGEYDDGSYGPVILRLAWHSSGTYDKDSNTGGSNYATMRFEPESVHDANAGLNIARDLMEKVKQEFPWISYGDLWTLGGVAAIEMQGPKIPWRPGRIDGLAAQATPDGRLPDASQGSDHLRNIFYRMGFNDQEIVALSGAHALGRCHSNRSTYEGPWTFSPTTLTNDYFKLLFDEKWVWKKWNGPKQLEDKKTKTLMMLPTDYVLTQDKSFKKHAKAYADDQDLFFRDFSKAVSRLFELGVPTEQFATPEPWLLPTVDEQKSAKEEAK

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns) and 7 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAACGCCCTCCGCGCCTCCCTCCGCACCGCTGCGCCTCTCCGTCGTGCAGCTGCTGGCAAGGCTCTCCCCCGTTCCTCCTTTTACCGCAAGTACTCGACGCCTCCCCCTCCG
GCTGCTGAGACGCCCAAGCCCAAGTCTGGGAACAACACCACGCTTTACCTCGGTCTTGCTGGTGTTGCGGCCATTGGTGTCACTTACTACTTTATCAGAGGCGAGGACGGTGCTGCTGCC
GTCAAGTCTATCCAGACCAAGGCAAAGTTTGTCCCCACCCAGCAGGATTACCAAAAG
GTTTGTTCCTCATCATGTCTAGTTTGCTTGGGACATTGTGCTCATTGTTCTGCGTAGGTGTAC
AACAGGGTTGCTGAGCTGTTGGACGAGGCTGGAGAGTATGATG
GCAAGTCTGTAATTGTAACCCACAAGTCTAAATACTGACCCACATTCCAGACGGCTCCTATGGTCCCGTCATCCTCC
GCCTTGCTTGGCACTCTTCTGGCACCTATGACAAGGATTCCAACACTGGTGGGAG
GTAAGTCTCATTCGCCTAAACACGCGTGCGTACACCTCAGGACACCGTCCCGAATAGCAATTACG
CCACCATGCGTTTCGAGCCCGAGTCCGTACACGATGCCAACGCCGGCTTGAACATCGCCCGTGACCTCATGGAAAAGGTCAAGCAGGAGTTCCCATGGATCTCCTACGGTGATCTTTGGA
CTCTTGGTGGTGTAGCTGCCATACAG
GTATATATATATATATTGATATCTTCAAAGCTATTTTGTTGACACGCTTGGCAGGAAATGCAAGGCCCCAAGATCCCCTGGCGTCCAGGCCGCA
TTGACGGTCTTGCAGCACAGGCGACCCCTGATGGCCGTCTTCCCGACGCTTCTCAAGGTTCGGATCACCTGCGCAAC
GTACGACCTTTTCATTCTTTTGTCCTGCTTTTCGTGAGCTAAC
CCACTTAATATTACAGATCTTCTACCGCATGGGGTACGTTCTCCACCTCCTTCCCAGTGGTATACTAGGACTAACCATCTTGTCTTAGCTTCAATGACCAAGAGATCGTCGCCCTCTCCG
GTGCCCACGCTCTTGGCCGCTGCCACTCAAACAG
GTGCGGCCTTCTTTCCATTTTGCGACTCCGCTCCGCATCTCACACCATTTTCCTCCCGCTTTAGGTCCACCTATGAAGGTCCCTGG
ACATTTTCCCCTACAACCCTGACAAACGACTACTTCAAGCTCCTGTTTGACGAAAAGTGGGTCTGGAAGAAATGGAATGGCCCCAAGCAGCTGGAGGATAAGAAGACAAAGACGCTCATG
ATGTTGCC
GTGCGTATTCGTATGCGATATCGAGAGGGAGAAATTAATGGGATGCGTAATATAGGACCGACTACGTCTTGACACAAGACAAGTCGTTCAAGAAGCACGCCAAGGCTTATGC
GGATGATCAGGATTTGTTCTTTAGGGA
GTACGTTGTCTTTTTGTTGATATTCCTTCTCCTTTTTTATTTTGCTGATTCGCATTGATATTCAGCTTCTCTAAAGCTGTGTCTCGCCTGTTC
GAGCTCGGTGTACCCACTGAGCAGTTCGCCACTCCCGAACCATGGCTCTTGCCAACGGTTGATGAGCAAAAGTCGGCCAAGGAGGAGGCCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCAACGCCCTCCGCGCCTCCCTCCGCACCGCTGCGCCTCTCCGTCGTGCAGCTGCTGGCAAGGCTCTCCCCCGTTCCTCCTTTTACCGCAAGTACTCGACGCCTCCCCCTCCG
GCTGCTGAGACGCCCAAGCCCAAGTCTGGGAACAACACCACGCTTTACCTCGGTCTTGCTGGTGTTGCGGCCATTGGTGTCACTTACTACTTTATCAGAGGCGAGGACGGTGCTGCTGCC
GTCAAGTCTATCCAGACCAAGGCAAAGTTTGTCCCCACCCAGCAGGATTACCAAAAG
GTGTACAACAGGGTTGCTGAGCTGTTGGACGAGGCTGGAGAGTATGATGACGGCTCCTATGGT
CCCGTCATCCTCCGCCTTGCTTGGCACTCTTCTGGCACCTATGACAAGGATTCCAACACTGGTGGGAG
CAATTACGCCACCATGCGTTTCGAGCCCGAGTCCGTACACGATGCCAACGCC
GGCTTGAACATCGCCCGTGACCTCATGGAAAAGGTCAAGCAGGAGTTCCCATGGATCTCCTACGGTGATCTTTGGACTCTTGGTGGTGTAGCTGCCATACAG
GAAATGCAAGGCCCCAAG
ATCCCCTGGCGTCCAGGCCGCATTGACGGTCTTGCAGCACAGGCGACCCCTGATGGCCGTCTTCCCGACGCTTCTCAAGGTTCGGATCACCTGCGCAAC
ATCTTCTACCGCATGGGCTTC
AATGACCAAGAGATCGTCGCCCTCTCCGGTGCCCACGCTCTTGGCCGCTGCCACTCAAACAG
GTCCACCTATGAAGGTCCCTGGACATTTTCCCCTACAACCCTGACAAACGACTACTTC
AAGCTCCTGTTTGACGAAAAGTGGGTCTGGAAGAAATGGAATGGCCCCAAGCAGCTGGAGGATAAGAAGACAAAGACGCTCATGATGTTGCC
GACCGACTACGTCTTGACACAAGACAAG
TCGTTCAAGAAGCACGCCAAGGCTTATGCGGATGATCAGGATTTGTTCTTTAGGGA
CTTCTCTAAAGCTGTGTCTCGCCTGTTCGAGCTCGGTGTACCCACTGAGCAGTTCGCCACTCCC
GAACCATGGCTCTTGCCAACGGTTGATGAGCAAAAGTCGGCCAAGGAGGAGGCCAAGTAA

Retrieve as FASTA