Entry information : Ccin2CysPrx
Entry ID 6520
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2009-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: Ccin2CysPrx
Name Ccin2CysPrx
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type Sporocarp (fruiting body)
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ccin2CysPrx
start..stop
S start..stop
Lbi2CysPrx 355 6e-127 1..211 1..219
Pc2CysPrx01-1 352 2e-125 1..211 1..211
Ppl2CysPrx01-1B 350 5e-125 1..211 1..210
Ppl2CysPrx01-1A 350 9e-125 1..211 1..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 628523..628623 101 N° 2 628689..628712 24 N° 3 628772..628795 24 N° 4 628846..628907 62
N° 5 628962..629160 199 N° 6 629229..629307 79 N° 7 629372..629518 147  
join(628523..628623,628689..628712,628772..628795,628846..628907,628962..629160, 629229..629307,629372..629518)


exon

Literature and cross-references Ccin2CysPrx
Literature Birren et al., Annotation of the Coprinopsis cinerea genome
DNA ref. JGI genome:   Chr_13 (628523..629515)
mRNA ref. GenBank:   XM_001838234 [Incorrect splicing]
EST ref. GenBank:   DN593040 [3' end]
Protein sequence: Ccin2CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211
PWM (Da):   %s   23399.15  
PI (pH):   %s   5.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPAIVQRPAPTFKAEAVTEGLFNEVSLQDYQGKWVVLFFYPMDFTFVCPTEILAFNDALPQFQELNTVVGVSTDSKFSHFAWATQPRKEGGLGPDLKLPLIADRNMKISRDYGVLLEDEGIALRGLFIIDPKGILRQITVNDLPVGRSVDETIRLIKAFQFEKYGEVCPANWTEGSKTIKTDPVAKLEYFGAANGEVNGEGPKKRPRTE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 1 EST. Strain="okayama7#130".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCTATCGTTCAACGCCCTGCTCCCACTTTCAAGGCTGAGGCCGTCACTGAGGGTCTCTTCAACGAGGTCTCTCTCCAGGACTACCAAGGAAAATGGTACGTCACGATATTAAAC
CACAAGTGCGGGGGAACTGACTAGATTTTGCTCGTTTTTCTTACAGGGTTGTTCTCTTCTTCTACCCTATGTGAGTTCTCAATATCCTTTGACTCCGTAAACGCGTCGTCGCTGACCACA
ATGCTTCAGGGATTTCACCTTCGTCTGCCCCACGTATGTCCCACTCGAATGAAAAAACGCCAGCGACCTAACAAGTATCCCAGCGAAATCCTTGCTTTCAATGACGCTCTTCCCCAGTTC
CAAGAATTGAACACCGTTGTTCTCG
GTACGGCTCTTCGTCGGGTGGCATGTGACATCCATGCTTAACGGCGGCTTTCAGGTGTCTCGACCGACTCCAAGTTCTCCCACTTCGCCTGGGCC
ACCCAGCCTCGCAAGGAAGGTGGTCTCGGCCCCGACCTCAAGCTCCCTCTCATTGCCGACCGAAACATGAAGATCTCTCGCGACTATGGTGTCCTCCTTGAGGACGAGGGTATCGCCCTC
CGTGGTTTGTTCATCATTGATCCGAAGGGTATCTTGAG
GTTCGTTGCTCGGTGTCCATCAAGAAGCATAAACGTTTGCTCATTGCACTATGTTCATATCCATTTAGGCAAATCACTGTTA
ATGATCTTCCTGTCGGCCGCTCTGTCGACGAGACCATCCGCCTCATCAAGGCTTTCCAATTCACT
GTTAGTTCCCATCCCCTTTGTCCCTCGTCGATATGTCATTGACTTATCGCCTCTG
CTCTAACAGGAGAAGTACGGCGAAGTGTGCCCCGCCAACTGGACCGAAGGCTCCAAGACCATCAAGACTGACCCTGTTGCTAAGTTGGAATACTTTGGTGCTGCCAATGGTGAAGTCAAC
GGTGAAGGCCCCAAGAAGCGCCCCCGCACCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCTATCGTTCAACGCCCTGCTCCCACTTTCAAGGCTGAGGCCGTCACTGAGGGTCTCTTCAACGAGGTCTCTCTCCAGGACTACCAAGGAAAATGGGTTGTTCTCTTCTTCTAC
CCTAT
GGATTTCACCTTCGTCTGCCCCACCGAAATCCTTGCTTTCAATGACGCTCTTCCCCAGTTCCAAGAATTGAACACCGTTGTTCTCGGTGTCTCGACCGACTCCAAGTTCTCCCAC
TTCGCCTGGGCCACCCAGCCTCGCAAGGAAGGTGGTCTCGGCCCCGACCTCAAGCTCCCTCTCATTGCCGACCGAAACATGAAGATCTCTCGCGACTATGGTGTCCTCCTTGAGGACGAG
GGTATCGCCCTCCGTGGTTTGTTCATCATTGATCCGAAGGGTATCTTGAG
GCAAATCACTGTTAATGATCTTCCTGTCGGCCGCTCTGTCGACGAGACCATCCGCCTCATCAAGGCTTTC
CAATTCACT
GAGAAGTACGGCGAAGTGTGCCCCGCCAACTGGACCGAAGGCTCCAAGACCATCAAGACTGACCCTGTTGCTAAGTTGGAATACTTTGGTGCTGCCAATGGTGAAGTCAAC
GGTGAAGGCCCCAAGAAGCGCCCCCGCACCGAGTAA

Retrieve as FASTA