Entry information : Lbi1CysPrx
Entry ID 6521
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2012-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2009-01-24 (Christophe Dunand)
Peroxidase information: Lbi1CysPrx
Name Lbi1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue types Mycelium
Sporocarp (fruiting body)
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Lbi1CysPrx
start..stop
S start..stop
Hcy1CysPrx 423 2e-153 1..222 1..222
Athi1CysPrx01 405 3e-146 1..222 1..222
Amus1CysPrx 403 1e-145 1..222 1..222
Ccin1CysPrx 400 1e-144 1..220 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1982560..1982655 96 N° 2 1982707..1982913 207 N° 3 1982971..1983063 93 N° 4 1983115..1983209 95
N° 5 1983260..1983270 11 N° 6 1983322..1983452 131 N° 7 1983504..1983545 42  
join(1982560..1982655,1982707..1982913,1982971..1983063,1983115..1983209,1983260 ..1983270,1983322..1983452,1983504..1983545)


exon

Literature and cross-references Lbi1CysPrx
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Martin F., and Podila,G.K. DOE Joint Genome Institute Laccaria bicolor EST project.
DNA ref. JGI genome:   LG_3 (1982560..1983545)
EST ref. GenBank:   EX797876.1
Protein sequence: Lbi1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24973.94  
PI (pH):   %s   6.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGNTAPDFEAVTTAGPIKFHEWIGDSWAILFSHPGDFTPVCTTELGEVARRGPDFANRNVKVIGISANGLEEHHKWVKDINDYGSKVAPTDVQFPIIADPDRKISTLYDMLDEQDATNRDAKGLPFTIRTVFVIDPKKVIRLTLAYPASTGRNFDEILRVISLQLGDKHRITTPVNWKKGDDVIVHPGVTNDEAKTLFPDYSQHLPYLRTTPLKVEKD

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 14 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCTCTACGACTTGGAAACACTGCTCCAGATTTTGAAGCCGTTACAACGGCTGGGCCCATTAAATTCCACGAATGGATTGGTGACTCCTGGGTACGTACAATGTAAGTATGTCCC
ATGTCTTATGATCTAATATCTCTTTAGGCTATCCTCTTCTCCCATCCTGGTGATTTCACCCCCGTTTGCACCACCGAACTTGGAGAAGTCGCCCGACGTGGGCCCGATTTCGCTAACCGC
AACGTAAAAGTCATCGGTATCTCCGCCAACGGACTCGAGGAACATCACAAATGGGTCAAGGATATCAATGATTATGGCTCAAAGGTTGCCCCCACAGATGTTCAGTTCCCCATC
GTATGT
TACAGATGTGTTGGCAATCGTTCGTTTGAATGAAGTGCATGGATATTTTAGATCGCCGACCCAGACAGGAAGATCTCGACGCTGTATGATATGTTGGACGAGCAAGACGCAACCAACCGC
GACGCAAAGGGTCTTCCTTTCACA
GTGAGGCTTTTTCTGTAGAACATTTGAATGAGAGACTTAATTGGGATGCAGATCCGAACTGTTTTCGTCATCGATCCCAAGAAGGTTATTCGTTTG
ACCCTGGCTTACCCTGCCTCCACTGGGCGCAATTTCGACGAGATTCTTCG
GTGGGTGCATTTTGTGATTCCACTAGCCTCCCATTGACAATCCCTTGCAGTGTTATTGATTGTAAAGCTT
CGTTAGCACATCTTCGGTGCTAAGCTGATATTCTTCCATTAGCTCTCCAGCTCGGCGACAAACACCGTATAACTACACCCGTCAACTGGAAGAAGGGAGACGATGTCATTGTTCATCCCG
GCGTCACAAACGATGAAGCAAAGACCCTGTTCCCCGACTACAGCCAGCACCTC
GTTTGTATTTTATCATTCTGGTTGCGTAAATGTTTCTAATGACATTCATAGCCATACCTGAGGACCA
CCCCTTTAAAAGTTGAAAAGGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCTCTACGACTTGGAAACACTGCTCCAGATTTTGAAGCCGTTACAACGGCTGGGCCCATTAAATTCCACGAATGGATTGGTGACTCCTGGGCTATCCTCTTCTCCCATCCTGGT
GATTTCACCCCCGTTTGCACCACCGAACTTGGAGAAGTCGCCCGACGTGGGCCCGATTTCGCTAACCGCAACGTAAAAGTCATCGGTATCTCCGCCAACGGACTCGAGGAACATCACAAA
TGGGTCAAGGATATCAATGATTATGGCTCAAAGGTTGCCCCCACAGATGTTCAGTTCCCCATC
ATCGCCGACCCAGACAGGAAGATCTCGACGCTGTATGATATGTTGGACGAGCAAGAC
GCAACCAACCGCGACGCAAAGGGTCTTCCTTTCACA
ATCCGAACTGTTTTCGTCATCGATCCCAAGAAGGTTATTCGTTTGACCCTGGCTTACCCTGCCTCCACTGGGCGCAATTTCGAC
GAGATTCTTCG
TGTTATTGATTCTCTCCAGCTCGGCGACAAACACCGTATAACTACACCCGTCAACTGGAAGAAGGGAGACGATGTCATTGTTCATCCCGGCGTCACAAACGATGAAGCA
AAGACCCTGTTCCCCGACTACAGCCAGCACCTC
CCATACCTGAGGACCACCCCTTTAAAAGTTGAAAAGGATTAA

Retrieve as FASTA