Entry information : Ccin1CysPrx
Entry ID 6522
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2009-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: Ccin1CysPrx
Name Ccin1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ccin1CysPrx
start..stop
S start..stop
Lbi1CysPrx 400 1e-144 1..220 1..220
Hcy1CysPrx 395 1e-142 1..220 1..220
Pc1CysPrx01 388 1e-139 1..220 1..220
Athi1CysPrx01 382 5e-137 1..219 1..219
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1376189..1376284 96 N° 2 1376336..1376542 207 N° 3 1376606..1376698 93 N° 4 1376755..1376849 95
N° 5 1376908..1376918 11 N° 6 1376977..1377107 131 N° 7 1377161..1377193 33  
join(1376189..1376284,1376336..1376542,1376606..1376698,1376755..1376849,1376908 ..1376918,1376977..1377107,1377161..1377193)


exon

Literature and cross-references Ccin1CysPrx
DNA ref. JGI genome:   Chr_5 (1376189..1377190)
EST ref. GenBank:   DY852401.1 [3' end]
Protein sequence: Ccin1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24595.8  
PI (pH):   %s   6.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGNTAPDFEADTTTGRIKFHEWIGDSWAILFSHPGDFTPVCTTELGEVARRAPDFAKRNVKVIGISANGLDEHHAWVKDIESYGAKVAPTQVSYPIIADPDRKIATLYDMLDEQDATNVDTKGLPLTIRTVFIIDPKKKIRLTLAYPASTGRNFDEIIRVISLQLGDKHRITTPVNWKQGEDVIVHASVTNDEAKTLFPEHTVHLPYLRTTPLKQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 2 ESTs. Strain="okayama7#130".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCCGACTTGGAAACACTGCCCCCGACTTCGAGGCCGATACCACTACTGGACGCATCAAGTTCCATGAGTGGATTGGTGACTCCTGGGTACGCGCTCTATAGATAAGATGT
CCGGACGATCTAATCTGTGATCGCCAGGCCATCCTCTTCTCTCATCCTGGTGACTTTACCCCCGTTTGCACCACCGAACTCGGTGAAGTCGCTCGACGAGCCCCCGACTTCGCCAAGAGG
AACGTAAAGGTTATCGGTATTTCTGCTAACGGCCTCGATGAGCACCACGCATGGGTCAAGGACATCGAGTCTTATGGTGCGAAGGTCGCCCCCACCCAAGTCTCTTACCCCATC
GTAAGT
GATACTTACCGGCGGTTCATTGAGCTTCTCTAACCCATTCACCGCTGCGGACACTAGATCGCCGATCCCGACAGGAAGATCGCCACCCTCTATGATATGTTGGACGAGCAGGATGCCACC
AACGTCGACACTAAGGGCCTTCCCCTTACC
GTAAGTCCCTGTGCCTGTGACCTGGAACGATACATTAATTCAATCGACGTTAATAGATCAGGACTGTCTTCATCATCGACCCAAAGAAGA
AAATCCGCCTCACCCTCGCATACCCTGCCTCCACTGGCCGTAACTTCGATGAGATCATTCG
GTAATTAATCCTCCGATTTTTCAGGGCATCGCTGAACTTCTCATTCCCGCTTTCACAGA
GTCATCGACT
GTGAGAACTGCGCAGTACAATGACAATTCCCGCGAAAGGCTAACTCTAACCTTCTTAGCTCTCCAACTCGGCGACAAGCACCGTATCACCACACCCGTCAACTGGAAGCA
GGGTGAAGATGTCATCGTCCACGCTAGCGTGACCAACGACGAGGCCAAGACCCTATTCCCTGAGCACACTGTTCACCTG
GTAAGATTTATCGTGGCCATCCCGTCGCTCATGCTGCTGAC
CCACCCCACCAGCCATACCTCCGAACCACCCCTCTCAAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCCGACTTGGAAACACTGCCCCCGACTTCGAGGCCGATACCACTACTGGACGCATCAAGTTCCATGAGTGGATTGGTGACTCCTGGGCCATCCTCTTCTCTCATCCTGGT
GACTTTACCCCCGTTTGCACCACCGAACTCGGTGAAGTCGCTCGACGAGCCCCCGACTTCGCCAAGAGGAACGTAAAGGTTATCGGTATTTCTGCTAACGGCCTCGATGAGCACCACGCA
TGGGTCAAGGACATCGAGTCTTATGGTGCGAAGGTCGCCCCCACCCAAGTCTCTTACCCCATC
ATCGCCGATCCCGACAGGAAGATCGCCACCCTCTATGATATGTTGGACGAGCAGGAT
GCCACCAACGTCGACACTAAGGGCCTTCCCCTTACC
ATCAGGACTGTCTTCATCATCGACCCAAAGAAGAAAATCCGCCTCACCCTCGCATACCCTGCCTCCACTGGCCGTAACTTCGAT
GAGATCATTCG
AGTCATCGACTCTCTCCAACTCGGCGACAAGCACCGTATCACCACACCCGTCAACTGGAAGCAGGGTGAAGATGTCATCGTCCACGCTAGCGTGACCAACGACGAGGCC
AAGACCCTATTCCCTGAGCACACTGTTCACCTG
CCATACCTCCGAACCACCCCTCTCAAGCAGTAG

Retrieve as FASTA