Entry information : LbiPrxQ02 (LbPrxQ2)
Entry ID 6523
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2012-04-06 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-22 (Achraf Jemmat)
Peroxidase information: LbiPrxQ02 (LbPrxQ2)
Name (synonym) LbiPrxQ02 (LbPrxQ2)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type Sporocarp (fruiting body)
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiPrxQ02
start..stop
S start..stop
PplPrxQ02 296 4e-103 1..226 1..227
CcinPrxQ 275 1e-94 1..226 1..229
AbPrxQ_bisporus 270 3e-92 15..224 22..244
AthiPrxQ 268 8e-92 78..224 98..244
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10013601..10013786 186 N° 2 10013867..10014044 178 N° 3 10014111..10014232 122 N° 4 10014293..10014447 155
N° 5 10014509..10014548 40  
join(10013601..10013786,10013867..10014044,10014111..10014232,10014293..10014447 ,10014509..10014548)


exon

Literature and cross-references LbiPrxQ02 (LbPrxQ2)
DNA ref. JGI genome:   LG_1 (10013601..10014548)
EST ref. GenBank:   EL739761.1 [3' end]
Cluster/Prediction ref. Genebank:   6074995 [Incorrect splicing]
Protein sequence: LbiPrxQ02 (LbPrxQ2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   24172.65  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPRTKTTENDADPPRRSGRIAALPTAESAQPKPKKAVASKKRPAAETVDATKEAEPSTVKKAKATAAEDEDEGNPTLATIDIGDSLPSLTLKNEKGEDVQVENLASEKGVILFLVPKADTPGCTNQACGFRDIYPDFTSLNYDVYCLSADTPAAQTKWQTKELPYPLLSDPKRLLISALGAGEGGKTKRSHFIFEQGGKLVDKKIPVKPADSPKLALDFIKSLQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCCACGCACTAAAACCACTGAAAACGACGCTGATCCCCCCAGACGCTCGGGGCGTATAGCAGCGTTGCCAACTGCCGAGTCTGCACAGCCCAAACCTAAGAAAGCCGTCGCGTCC
AAGAAGAGACCAGCTGCGGAGACGGTGGACGCCACGAAGGAGGCTGAACCATCGACTGTGAAAAAG
GTGCACACACGCTCGCTCTATCTCGGGGCTCTTCTCTCGTGTTCGTGGGGTGCT
TTCCTGATACTCGAACGTAATACTAGGCTAAAGCTACTGCGGCTGAGGATGAAGACGAAGGAAACCCAACATTGGCCACGATAGACATTGGCGACAGCCTACCAAGCCTCACGCTCAAAA
ACGAGAAGGGCGAGGATGTTCAGGTCGAAAACCTGGCGTCGGAGAAGGGCGTTATCCTCTTCTTGGTGCCCAAGGCAGATACCC
GTACGTATTGGCTTGCCTAGGGCGATTTCGTGTGGA
TCCTCAACACGGCGCGTGCCACGTTTTTAGCTGGGTGCACAAACCAAGCTTGTGGCTTCCGCGATATTTACCCTGATTTCACTTCATTAAACTACGATGTCTACTGCTTGAGCGCAGACA
CCCCTGCTGCACAGACAAAGTGGCAGACGAAG
GTGAGTCTTGGTTTACTTTCCCGCGGCACCCTGCACTCAGACCCTATTTCCCTCTTCTAGAAAGAGCTTCCGTATCCCCTGCTGTCTG
ACCCGAAGAGGTTACTGATTTCTGCCTTGGGCGCAGGCGAAGGCGGGAAGACTAAGAGGAGCCATTTTATCTTTGAGCAAGGGGGCAAACTGGTAGATAAGAAAATCCCAGTAAAACCTG
CTGATAG
GTTTGTCTTCATGTTAAACTTGAATTTTATACCTTGGGAGTTAATCTTTATTGTTTATCAGTCCCAAACTTGCTCTTGACTTTATCAAGAGTCTTCAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCCACGCACTAAAACCACTGAAAACGACGCTGATCCCCCCAGACGCTCGGGGCGTATAGCAGCGTTGCCAACTGCCGAGTCTGCACAGCCCAAACCTAAGAAAGCCGTCGCGTCC
AAGAAGAGACCAGCTGCGGAGACGGTGGACGCCACGAAGGAGGCTGAACCATCGACTGTGAAAAAG
GCTAAAGCTACTGCGGCTGAGGATGAAGACGAAGGAAACCCAACATTGGCCACG
ATAGACATTGGCGACAGCCTACCAAGCCTCACGCTCAAAAACGAGAAGGGCGAGGATGTTCAGGTCGAAAACCTGGCGTCGGAGAAGGGCGTTATCCTCTTCTTGGTGCCCAAGGCAGAT
ACCC
CTGGGTGCACAAACCAAGCTTGTGGCTTCCGCGATATTTACCCTGATTTCACTTCATTAAACTACGATGTCTACTGCTTGAGCGCAGACACCCCTGCTGCACAGACAAAGTGGCAG
ACGAAG
AAAGAGCTTCCGTATCCCCTGCTGTCTGACCCGAAGAGGTTACTGATTTCTGCCTTGGGCGCAGGCGAAGGCGGGAAGACTAAGAGGAGCCATTTTATCTTTGAGCAAGGGGGC
AAACTGGTAGATAAGAAAATCCCAGTAAAACCTGCTGATAG
TCCCAAACTTGCTCTTGACTTTATCAAGAGTCTTCAATGA

Retrieve as FASTA