Entry information : LbiGPx
Entry ID 6525
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2012-04-06 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: LbiGPx
Name LbiGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiGPx
start..stop
S start..stop
LameGPx01 321 1e-114 1..161 32..192
HcyGPx01 291 2e-102 1..161 48..208
GmarGPx02 288 4e-101 1..161 53..213
GsppGPx01 285 9e-100 1..161 73..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3563443..3563555 113 N° 2 3563298..3563388 91 N° 3 3563072..3563245 174 N° 4 3562911..3563018 108
complement(join(3562911..3563018,3563072..3563245,3563298..3563388,3563443..3563 555))


exon

Literature and cross-references LbiGPx
Protein ref. UniProtKB:   B0DA76
DNA ref. JGI genome:   LG_3 (3563555..3562911)
Protein sequence: LbiGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   161
PWM (Da):   %s   18141.11  
PI (pH):   %s   5.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDSGFYSLKAERPGGKEYSFSELKGKVVLIVNVASKCGFTPQYKGLQDLYLKYKDQNFVILGFPCNFGGQEPEDDKGIEEFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKEEKSGIFGLTRIKWNFEKFLVDKEGNVVQRWASTTTPQAIDEEVAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs (EX794785, EL739305).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGATTCTGGATTTTATTCTCTCAAGGCCGAGCGTCCTGGAGGCAAGGAGTACTCTTTCTCCGAACTGAAGGGAAAGGTTGTGCTCATCGTCAACGTTGCTTCAAAATGGTGCGTC
TACCACCAACCCGCCGTTGGCTTCTTCGAACTTACGACGCCTTTCAGCGGGTTCACTCCACAATACAAGGGACTGCAGGATTTGTACTTGAAGTACAAGGATCAGAACTTCGTCATCCTT
GGGTTCCCTTGTAACCAG
GTAAGCCTTAACCAACTTTCCTATCTCCTGAATGACGTCATTGCCTGAGTAGTTTGGAGGTCAAGAGCCAGAAGACGACAAGGGGATCGAAGAGTTTTGCAC
GCTCAACCACGGCGTCACATTCCCACTCATGAAAAAGTCCGATGTCAATGGAGACAATACCAACGAGGTCTACAAATGGCTGAAGGAAGAGAAATCCGGGATCTTTGGGCTCACGAGAAT
CAAG
GTGGGTATCTTTTGACACTACAATTGAGGTCAAGACGCTCAAGGCATGAAAAGTGGAATTTCGAAAAGTTCCTCGTCGACAAAGAGGGGAACGTCGTTCAACGATGGGCGTCCACG
ACGACACCACAAGCGATTGACGAGGAAGTTGCGAAACTCTTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGATTCTGGATTTTATTCTCTCAAGGCCGAGCGTCCTGGAGGCAAGGAGTACTCTTTCTCCGAACTGAAGGGAAAGGTTGTGCTCATCGTCAACGTTGCTTCAAAATGCGGGTTC
ACTCCACAATACAAGGGACTGCAGGATTTGTACTTGAAGTACAAGGATCAGAACTTCGTCATCCTTGGGTTCCCTTGTAACCAG
TTTGGAGGTCAAGAGCCAGAAGACGACAAGGGGATC
GAAGAGTTTTGCACGCTCAACCACGGCGTCACATTCCCACTCATGAAAAAGTCCGATGTCAATGGAGACAATACCAACGAGGTCTACAAATGGCTGAAGGAAGAGAAATCCGGGATCTTT
GGGCTCACGAGAATCAAG
TGGAATTTCGAAAAGTTCCTCGTCGACAAAGAGGGGAACGTCGTTCAACGATGGGCGTCCACGACGACACCACAAGCGATTGACGAGGAAGTTGCGAAACTC
TTATGA

Retrieve as FASTA