Entry information : CcinGPx
Entry ID 6526
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2009-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: CcinGPx
Name CcinGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinGPx
start..stop
S start..stop
MfiaGPx01 249 2e-86 5..174 2..167
PstrGPx01 251 8e-86 2..168 92..254
HsubGPx01 245 3e-84 2..168 48..210
BeduGPx01 244 4e-83 9..174 90..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2274023..2274124 102 N° 2 2274222..2274344 123 N° 3 2274410..2274583 174 N° 4 2274643..2274768 126
join(2274023..2274124,2274222..2274344,2274410..2274583,2274643..2274768)


exon

Literature and cross-references CcinGPx
Protein ref. UniProtKB:   A8NUA0 [Incorrect splicing]
DNA ref. JGI genome:   Chr_4 (2274023..2274765)
Protein sequence: CcinGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   19331.73 Transmb domain:   %s   o31-53i
PI (pH):   %s   5.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTESSSGFYSLKAELPNGQTYDFEQLRGKVVLIACSHFNGVLLLGVTFLPSGLQQLYEKYKDRGFTILGFPCNQFGGQEPADDAGIQEFCTVNHGVTFPLMKKSEVNGDNTNEVYQWLKSKKAGFLGLTRIKWNFEKFLVDKEGNVVNRWASTTSPSSIASEIEKLLTEEPRL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACTGAATCATCTTCTGGCTTTTACTCTCTGAAGGCTGAACTGCCCAATGGACAAACCTACGACTTTGAACAACTTCGTGGCAAGGTTGTGTTGATTGTGAATACTGCATCCAAA
TGGTTTAGTCCCACCTTTCAGTTAAAATGTGTAGGATTTACTGACCGATTTTAAAGTGGATTTACTCCTCAATACAAAGGCGTGTTCTCATTTTAATGGCGTTCTTTTGCTTGGAGTGAC
ATTTTTGCCCTCAGGTTTGCAACAACTGTACGAGAAGTACAAGGATAGAGGATTCACTATTCTCGGCTTCCCTTGCAACCAG
GTTCGTCCTTTGCAATCGCGTTAGGGAGGGGGTCTGAT
CGGCCTCCCATCCTTTCCCCCCTCTAGTTCGGTGGGCAAGAACCTGCGGACGATGCTGGTATTCAAGAATTCTGCACGGTGAACCATGGCGTCACTTTCCCCCTTATGAAGAAATCCGAG
GTGAACGGAGACAACACCAACGAAGTTTATCAATGGCTAAAGAGCAAGAAGGCTGGTTTCTTGGGCCTCACGAGAATCAAG
GTGTGTGCTGTGCCGCCTTACCAGTTCTTTCTCCTAAAA
GCTCAATGGCGGTTTGGTAGTGGAACTTTGAAAAGTTTTTGGTCGACAAGGAGGGAAATGTTGTGAATCGCTGGGCCTCAACCACATCCCCTTCGTCTATCGCCTCTGAGATTGAGAAGC
TGTTGACCGAGGAACCGAGATTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACTGAATCATCTTCTGGCTTTTACTCTCTGAAGGCTGAACTGCCCAATGGACAAACCTACGACTTTGAACAACTTCGTGGCAAGGTTGTGTTGATTGCGTGTTCTCATTTTAAT
GGCGTTCTTTTGCTTGGAGTGACATTTTTGCCCTCAGGTTTGCAACAACTGTACGAGAAGTACAAGGATAGAGGATTCACTATTCTCGGCTTCCCTTGCAACCAG
TTCGGTGGGCAAGAA
CCTGCGGACGATGCTGGTATTCAAGAATTCTGCACGGTGAACCATGGCGTCACTTTCCCCCTTATGAAGAAATCCGAGGTGAACGGAGACAACACCAACGAAGTTTATCAATGGCTAAAG
AGCAAGAAGGCTGGTTTCTTGGGCCTCACGAGAATCAAG
TGGAACTTTGAAAAGTTTTTGGTCGACAAGGAGGGAAATGTTGTGAATCGCTGGGCCTCAACCACATCCCCTTCGTCTATC
GCCTCTGAGATTGAGAAGCTGTTGACCGAGGAACCGAGATTGTAG

Retrieve as FASTA