Entry information : LbiDyPrx01
Entry ID 6533
Creation 2009-01-26 (Christophe Dunand)
Last sequence changes 2009-01-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiDyPrx01
Name LbiDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiDyPrx01
start..stop
S start..stop
HcyDyPrx02 656 0 21..500 10..484
HsubDyPrx02 629 0 18..500 1..487
GmarDyPrx01 627 0 22..500 3..484
HsubDyPrx01 598 0 24..500 6..489
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 149588..149700 113 N° 2 149319..149538 220 N° 3 148589..149259 671 N° 4 148255..148535 281
N° 5 148144..148198 55 N° 6 147913..148090 178  
complement(join(147913..148090,148144..148198,148255..148535,148589..149259,1493 19..149538,149588..149700))


exon

Literature and cross-references LbiDyPrx01
DNA ref. JGI genome:   scaffold_18 (149700..147913)
Protein sequence: LbiDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   505
PWM (Da):   %s   54822.36  
PI (pH):   %s   6.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAPGALSTTSTSATSLIAPPATPPDTLDLDNIQGDILSGLPKKTQSYIFFQIVDVTKFRADLARFVPFVKTVAGVLKDRDLIKEHKKKGHKTLIPLVGVNIAFSHLGFVLGIDDSSLGGATDPFIIGQFKDSTQNLGDAGTQTTSGLVPNWDPAFVQPLHGVILISGESHETLHKKKLEIECIFGVRTIQPSIFEVTSLRGDVRPGVESGHEHFGFLDGISNPAVTGFDKDPNPGPVPVNPGVIVTGHTGDLDQATRAAWAVDGSFLVFRYLFQQVPEFNDFLQKNPIAFQDLTPEEGSDLLGARLVGRWKSGAPIDLSPFKDDPMLAADPKRNNDFKIEGEINSQFRCPFAAHVRRTNPRNDLEALPPPVGPISVQKNRILRRGVQFGPELTKEEKTTAKTEYGRGLLFACYQTSITNGFQFLQAWANNPKFPLGQTQPEEPGLDPLIGQGVRSMSGTDPNNEEKVINGMPDFIIPRGGEYFFSPSLKGLRETLASPPVTA

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCACCTGGAGCTCTTTCGACTACTAGCACTTCCGCCACATCATTGATCGCTCCCCCTGCTACGCCTCCAGATACCCTGGACCTCGATAATATCCAGGGAGACATCTTGTACAAA
TTATTTCTTCGTCGTCAATATCATTATTGAACGCCATTATAGGAGCGGCCTTCCAAAAAAGACTCAGTCATATATTTTCTTCCAGATCGTCGACGTTACAAAATTTAGGGCGGATCTTGC
TCGATTCGTACCATTCGTCAAGACGGTAGCGGGGGTTCTCAAAGACAGAGACCTGATCAAAGAACACAAGAAGAAGGGGCATAAGACCCTTATCCCACTGGTTGGTGTGAATATTGCGTT
CTCCCATCTCGGCTTTGTCAAA
GTAATTTCTTCAGCGATTACTTGTGTAATATCGCTGACGATGCACCCCGTTTTTTCTAGCTTGGTATTGATGACAGCTCCTTGGGTGGCGCCACAGAT
CCATTCATCATCGGACAGTTCAAAGACTCCACCCAAAACCTCGGAGACGCAGGAACGCAAACTACCTCGGGACTCGTACCAAACTGGGACCCAGCCTTTGTCCAACCCTTACACGGAGTC
ATCCTCATTTCCGGAGAAAGTCACGAAACACTTCACAAGAAGAAACTTGAAATCGAGTGCATCTTCGGCGTTCGCACTATCCAACCTTCGATCTTCGAGGTCACCAGCCTCAGGGGTGAC
GTACGACCTGGAGTTGAGTCGGGGCACGAGCACTTTGGGTTCCTCGACGGAATTTCGAACCCGGCCGTCACTGGGTTTGATAAAGATCCTAACCCCGGACCTGTGCCCGTTAATCCAGGA
GTTATCGTCACCGGACACACAGGAGACCTCGACCAAGCCACAAGAGCTGCGTGGGCGGTCGATGGCAGCTTCCTCGTCTTCCGTTACCTGTTCCAGCAGGTACCTGAGTTTAACGACTTC
CTCCAGAAGAATCCTATTGCCTTCCAGGACCTTACCCCTGAGGAGGGAAGCGACCTTCTTGGTGCCAGGTTGGTAGGTCGCTGGAAGAGCGGTGCTCCGATCGACTTGTCTCCCTTCAAG
GATGACCCCATGCTTGCAGCGGATCCTAAGCG
GTGTGACCCCCTCTTCCCACGTTGGGTATACAGATTACTGACCCGGACCTTAGCAACAACGATTTCAAGATTGAAGGGGAGATCAACT
CACAATTCCGCTGCCCTTTTGCCGCACACGTCAGGAGGACCAACCCACGTAACGACTTGGAAGCCCTGCCACCCCCGGTTGGACCCATTTCAGTCCAGAAGAATCGCATTTTGCGCCGTG
GTGTGCAGTTCGGCCCTGAACTCACGAAAGAGGAGAAGACGACTGCGAAAACCGAGTATGGTCGGGGACTCCTCTTTGCTTGTTATCAAACTAGCATCACGAACGGGTTCCAATTCCTTC
AGAAAG
GTGCACAGTTCTGAATTCTCGTACCTATTGCTTCTTCGTTTGACATCTTCACTTAGCGTGGGCGAACAATCCCAAGTTTCCTCTCGGACAAACACAGCCTGAGGAACCCGGGTG
AGTTATATAAGACGCTTAATCAAGGGCACCTGGTGATAACTTGATTCCAGATTGGATCCTCTTATTGGGCAAGGTGTTCGCAGCATGTCGGGGACTGATCCCAATAACGAGGAGAAGGTT
ATCAACGGAATGCCTGATTTCATCATTCCTCGCGGCGGTGAATACTTCTTCTCCCCCTCTTTGAAAGGTTTGAGGGAAACTTTGGCATCCCCTCCTGTTACTGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCACCTGGAGCTCTTTCGACTACTAGCACTTCCGCCACATCATTGATCGCTCCCCCTGCTACGCCTCCAGATACCCTGGACCTCGATAATATCCAGGGAGACATCTTGAGCGGC
CTTCCAAAAAAGACTCAGTCATATATTTTCTTCCAGATCGTCGACGTTACAAAATTTAGGGCGGATCTTGCTCGATTCGTACCATTCGTCAAGACGGTAGCGGGGGTTCTCAAAGACAGA
GACCTGATCAAAGAACACAAGAAGAAGGGGCATAAGACCCTTATCCCACTGGTTGGTGTGAATATTGCGTTCTCCCATCTCGGCTTTGTCAAA
CTTGGTATTGATGACAGCTCCTTGGGT
GGCGCCACAGATCCATTCATCATCGGACAGTTCAAAGACTCCACCCAAAACCTCGGAGACGCAGGAACGCAAACTACCTCGGGACTCGTACCAAACTGGGACCCAGCCTTTGTCCAACCC
TTACACGGAGTCATCCTCATTTCCGGAGAAAGTCACGAAACACTTCACAAGAAGAAACTTGAAATCGAGTGCATCTTCGGCGTTCGCACTATCCAACCTTCGATCTTCGAGGTCACCAGC
CTCAGGGGTGACGTACGACCTGGAGTTGAGTCGGGGCACGAGCACTTTGGGTTCCTCGACGGAATTTCGAACCCGGCCGTCACTGGGTTTGATAAAGATCCTAACCCCGGACCTGTGCCC
GTTAATCCAGGAGTTATCGTCACCGGACACACAGGAGACCTCGACCAAGCCACAAGAGCTGCGTGGGCGGTCGATGGCAGCTTCCTCGTCTTCCGTTACCTGTTCCAGCAGGTACCTGAG
TTTAACGACTTCCTCCAGAAGAATCCTATTGCCTTCCAGGACCTTACCCCTGAGGAGGGAAGCGACCTTCTTGGTGCCAGGTTGGTAGGTCGCTGGAAGAGCGGTGCTCCGATCGACTTG
TCTCCCTTCAAGGATGACCCCATGCTTGCAGCGGATCCTAAGCG
CAACAACGATTTCAAGATTGAAGGGGAGATCAACTCACAATTCCGCTGCCCTTTTGCCGCACACGTCAGGAGGACC
AACCCACGTAACGACTTGGAAGCCCTGCCACCCCCGGTTGGACCCATTTCAGTCCAGAAGAATCGCATTTTGCGCCGTGGTGTGCAGTTCGGCCCTGAACTCACGAAAGAGGAGAAGACG
ACTGCGAAAACCGAGTATGGTCGGGGACTCCTCTTTGCTTGTTATCAAACTAGCATCACGAACGGGTTCCAATTCCTTCAGAAAG
CGTGGGCGAACAATCCCAAGTTTCCTCTCGGACAA
ACACAGCCTGAGGAACCCGG
ATTGGATCCTCTTATTGGGCAAGGTGTTCGCAGCATGTCGGGGACTGATCCCAATAACGAGGAGAAGGTTATCAACGGAATGCCTGATTTCATCATTCCT
CGCGGCGGTGAATACTTCTTCTCCCCCTCTTTGAAAGGTTTGAGGGAAACTTTGGCATCCCCTCCTGTTACTGCCTGA

Retrieve as FASTA