Entry information : LbiAPx-CcP
Entry ID 6534
Creation 2009-01-30 (Christophe Dunand)
Last sequence changes 2009-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiAPx-CcP
Name LbiAPx-CcP
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer Infected host
Repressor N/D
Best BLASTp hits
Perox score E-value LbiAPx-CcP
start..stop
S start..stop
LameAPx-CcP01 1118 0 1..599 1..591
HsubAPx-CcP02 791 0 7..562 6..559
HcyAPx-CcP02 763 0 19..575 21..584
GmarAPx-CcP10 758 0 1..574 1..575
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1359130..1359342 213 N° 2 1358994..1359080 87 N° 3 1358877..1358943 67 N° 4 1358503..1358824 322
N° 5 1358340..1358453 114 N° 6 1358110..1358284 175 N° 7 1357631..1358062 432 N° 8 1357193..1357585 393
complement(join(1357193..1357585,1357631..1358062,1358110..1358284,1358340..1358 453,1358503..1358824,1358877..1358943,1358994..1359080,1359130..1359342))


exon

Literature and cross-references LbiAPx-CcP
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Martin F., and Podila,G.K. DOE Joint Genome Institute Laccaria bicolor EST project
DNA ref. JGI genome:   LG_2 (1359342..1357193)
mRNA ref. GenBank:   XM_001875289
EST ref. GenBank:   EX807191.1 [5' end]   EX807190.1 [3' end]
Protein sequence: LbiAPx-CcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   600 (579)
PWM (Da):   %s   64594.85 (62260.7) Transmb domain:   %s   o577-599i (o556-578i)
PI (pH):   %s   5.53 (5.08) Peptide Signal:   %s   cut: 22 range:22-600
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHHLPLALYLCLSVFTHLSSAYTWPSPQYDALEGLLYEGRKSDGSSLSSIVHPCRKRTGTLASIAAEWLRFAFHDMATHNVNNGTGGLDGSLVYELDRPENFGLGFNQTASDFENYPNKLVSRADIISIGAIFAVATCGGPIIPFRGGRIDAYSAGNFGTPQPQDDLGSLTTSFQNQGFNTAEMIKLVACGHTMGGVRSSDFPELVPAGPDPNVPNIANFDTTTQFDNAVVTEYLSGYTKNVLVVTSNKTMASDLRVFQSDGNSTMRSLTSASTFASECQSIFARMLDTVPAGVTLTDEITLLPVKVNGVQLSIEEQKLVFKASLRLIQPINATANAKRTVTMLWCDKYGSAAACKGATRSSLPVNTLSDDPNISPVTLNLGYYFINYNFVVPIDSAASISKFWFQVDEHNGTAATTYNNGGSGYVLPQDQIFFVPKLSHVDNVQNMTYTQVYTNRDGSAYTHVYTIVAAVRNDTTPSRVYVNGFDSSVHGYPYYVNVTVDLALNSSLSSGVPGYNLYSGIVNDSGYQLTLDLHATSGGATYTQDFVATTFLDNTPYVAPSTPSNAAVKSSGSRSSFAHVFGWTPVACSLSLIVALTFWR

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns) and 5 ESTs. Strain="S238N-H82".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCATCTTCCACTCGCTCTCTATCTCTGTCTTTCTGTCTTTACTCATTTATCCTCTGCCTACACATGGCCGTCACCACAATACGACGCCCTCGAAGGCCTGCTTTACGAGGGCAGG
AAAAGTGACGGTTCCAGCTTGTCTTCGATCGTCCATCCCTGCCGAAAACGCACCGGGACTCTTGCGTCAATTGCGGCGGAATGGCTGCGTTTC
GTAAGTAGTCGCTCGCTGACTTCCACT
TCGTGCTTAGGGTTTGATCCAGGCTTTTCATGATATGGCAACACATAATGTTAATAACGGGACTGGTGGACTTGACGGTTCCCTCGTGTATGAGCTTGACCGACCCGAGGTGTGTCACAC
ACTCTATTTTATTTTATCCTTGTTTTAAGCGTTTTTTAGAACTTTGGTTTGGGCTTCAACCAGACTGCGTCTGATTTTGAGAACTACCCGAATAAATTGGTTTCTCGTACTTTGCATTTT
CTTTTTGTCCATTGTTCTACTCTCAACTTCGTTGACAGGTGCCGATATCATCTCGATTGGAGCCATCTTTGCAGTTGCGACGTGCGGCGGTCCCATCATTCCCTTCCGTGGTGGTCGTAT
CGACGCCTACTCCGCGGGTAACTTTGGAACACCCCAACCGCAGGATGACTTAGGGTCTCTCACCACCAGTTTCCAAAACCAGGGTTTCAACACCGCAGAGATGATCAAACTCGTTGCCTG
TGGACATACCATGGGTGGTGTTCGGAGCTCCGATTTCCCTGAACTTGTCCCCGCTGGCCCGGATCCGAATGTCCCGAACATCGCAAATTTCGATACAACTACCCAATTTGACAATGCCGT
GTAAGCAAAACTATTCTCGAGGCCTTCCCGTCATTTACTTTAAATCAAGAGTGACTGAATACCTCTCTGGATATACTAAGAATGTTCTCGTGGTAACGTCCAATAAAACCATGGCCTCCG
ATCTGCGGGTATTCCAGAGTGATGGCAACAGCACTATGCGCAG
GTATTGCTGGATTCGTCACTTTCAAAGAAATCCTTTGACACTATTACCAATTTAGTCTCACTTCAGCCTCTACCTTT
GCCTCTGAATGTCAATCCATTTTTGCACGCATGCTCGACACTGTTCCCGCAGGTGTCACTTTGACCGACGAAATTACCCTTTTACCTGTCAAGGTTAATGGAGTGCAACTATCCATTGAG
GAACAGAAGCTTGTCTTCAAGGCATCCTTGCGT
GTAAGTACAACGTTCTCTTCTAATATCTCGTGCTAATTAAATCCAAGCTTATTCAACCAATAAACGCGACAGCAAACGCCAAACGAA
CCGTGACAATGCTGTGGTGCGATAAGTACGGTAGTGCCGCAGCCTGCAAAGGAGCCACCAGGTCCTCTTTACCAGTCAACACGCTTAGTGACGATCCAAACATTTCTCCAGTGACCTTGA
ATCTCGGGTACTACTTTATCAACTACAATTTCGTCGTCCCCATCGACTCCGCGGCTTCTATATCAAAGTTCTGGTTCCAGGTGGATGAACATAACGGAACAGCCGCGACCACTTACAATA
ATGGTGGCAGTGGTTATGTGCTACCCCAGGATCAAATCTTCTTCGTCCCAAAGTTGAGCCATGTCGATAATGTGCAGAACATGACTTATACCCAGGTGTACACAAATCGTGATGGATCGG
CATATACCCATGTGTACACCATCGTCGCTGCT
GTGCGTTTCATTCTATTTACATCAACGTCGCTGATATCCTTTTAGGTCCGCAACGATACGACTCCGTCTCGTGTTTACGTGAATGGAT
TCGACAGTTCAGTCCACGGTTACCCGTATTATGTCAACGTCACTGTCGACCTCGCATTGAACTCGTCTTTGAGTTCCGGAGTTCCTGGGTATAACCTGTACTCCGGGATCGTCAACGACT
CTGGTTATCAGCTCACGCTGGACCTTCATGCCACCTCTGGAGGAGCCACGTATACGCAGGATTTCGTGGCGACTACGTTCTTAGATAATACTCCCTACGTCGCACCAAGTACCCCGAGTA
ACGCTGCTGTAAAGTCGTCAGGCAGCCGTAGCTCTTTTGCCCATGTTTTCGGATGGACCCCAGTCGCATGTTCTTTAAGCTTGATCGTGGCACTGACATTTTGGAGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCATCTTCCACTCGCTCTCTATCTCTGTCTTTCTGTCTTTACTCATTTATCCTCTGCCTACACATGGCCGTCACCACAATACGACGCCCTCGAAGGCCTGCTTTACGAGGGCAGG
AAAAGTGACGGTTCCAGCTTGTCTTCGATCGTCCATCCCTGCCGAAAACGCACCGGGACTCTTGCGTCAATTGCGGCGGAATGGCTGCGTTTC
GCTTTTCATGATATGGCAACACATAAT
GTTAATAACGGGACTGGTGGACTTGACGGTTCCCTCGTGTATGAGCTTGACCGACCCGAG
AACTTTGGTTTGGGCTTCAACCAGACTGCGTCTGATTTTGAGAACTACCCGAATAAATTG
GTTTCTC
GTGCCGATATCATCTCGATTGGAGCCATCTTTGCAGTTGCGACGTGCGGCGGTCCCATCATTCCCTTCCGTGGTGGTCGTATCGACGCCTACTCCGCGGGTAACTTTGGAACA
CCCCAACCGCAGGATGACTTAGGGTCTCTCACCACCAGTTTCCAAAACCAGGGTTTCAACACCGCAGAGATGATCAAACTCGTTGCCTGTGGACATACCATGGGTGGTGTTCGGAGCTCC
GATTTCCCTGAACTTGTCCCCGCTGGCCCGGATCCGAATGTCCCGAACATCGCAAATTTCGATACAACTACCCAATTTGACAATGCCGT
AGTGACTGAATACCTCTCTGGATATACTAAG
AATGTTCTCGTGGTAACGTCCAATAAAACCATGGCCTCCGATCTGCGGGTATTCCAGAGTGATGGCAACAGCACTATGCGCAG
TCTCACTTCAGCCTCTACCTTTGCCTCTGAATGTCAA
TCCATTTTTGCACGCATGCTCGACACTGTTCCCGCAGGTGTCACTTTGACCGACGAAATTACCCTTTTACCTGTCAAGGTTAATGGAGTGCAACTATCCATTGAGGAACAGAAGCTTGTC
TTCAAGGCATCCTTGCGT
CTTATTCAACCAATAAACGCGACAGCAAACGCCAAACGAACCGTGACAATGCTGTGGTGCGATAAGTACGGTAGTGCCGCAGCCTGCAAAGGAGCCACCAGG
TCCTCTTTACCAGTCAACACGCTTAGTGACGATCCAAACATTTCTCCAGTGACCTTGAATCTCGGGTACTACTTTATCAACTACAATTTCGTCGTCCCCATCGACTCCGCGGCTTCTATA
TCAAAGTTCTGGTTCCAGGTGGATGAACATAACGGAACAGCCGCGACCACTTACAATAATGGTGGCAGTGGTTATGTGCTACCCCAGGATCAAATCTTCTTCGTCCCAAAGTTGAGCCAT
GTCGATAATGTGCAGAACATGACTTATACCCAGGTGTACACAAATCGTGATGGATCGGCATATACCCATGTGTACACCATCGTCGCTGCT
GTCCGCAACGATACGACTCCGTCTCGTGTT
TACGTGAATGGATTCGACAGTTCAGTCCACGGTTACCCGTATTATGTCAACGTCACTGTCGACCTCGCATTGAACTCGTCTTTGAGTTCCGGAGTTCCTGGGTATAACCTGTACTCCGGG
ATCGTCAACGACTCTGGTTATCAGCTCACGCTGGACCTTCATGCCACCTCTGGAGGAGCCACGTATACGCAGGATTTCGTGGCGACTACGTTCTTAGATAATACTCCCTACGTCGCACCA
AGTACCCCGAGTAACGCTGCTGTAAAGTCGTCAGGCAGCCGTAGCTCTTTTGCCCATGTTTTCGGATGGACCCCAGTCGCATGTTCTTTAAGCTTGATCGTGGCACTGACATTTTGGAGA
TGA

Retrieve as FASTA