Entry information : LbiCIIBC01
Entry ID 6535
Creation 2009-05-13 (Christophe Dunand)
Last sequence changes 2012-10-26 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-04-30 (Christophe Dunand)
Peroxidase information: LbiCIIBC01
Name LbiCIIBC01
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiCIIBC01
start..stop
S start..stop
LameCIIBC01 620 0 1..345 1..344
GmarCIIBC06 469 3e-167 1..343 1..341
HsubCIIBC03 450 8e-160 1..344 1..343
HsubCIIBC02 449 2e-159 1..344 1..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4251026..4251152 127 N° 2 4250906..4250970 65 N° 3 4250802..4250856 55 N° 4 4250690..4250752 63
N° 5 4250615..4250627 13 N° 6 4250498..4250563 66 N° 7 4250326..4250447 122 N° 8 4250176..4250270 95
N° 9 4250106..4250120 15 N° 10 4250030..4250055 26 N° 11 4249959..4249973 15 N° 12 4249849..4249899 51
N° 13 4249712..4249791 80 N° 14 4249526..4249656 131 N° 15 4249386..4249463 78 N° 16 4249295..4249330 36
complement(join(4249295..4249330,4249386..4249463,4249526..4249656,4249712..4249 791,4249849..4249899,4249959..4249973,4250030..4250055,4250106..4250120,4250176. .4250270,4250326..4250447,4250498..4250563,4250615..4250627,4250690..4250752,425 0802..4250856,4250906..4250970,4251026..4251152))


exon

Literature and cross-references LbiCIIBC01
Literature Peter,M., Courty,P.-E., Kohler,A., Delaruelle,C., Martin,D., Tagu ,D., Frey-Klett,P., Duplessis,S., Chalot,M., Podila,G. and Martin ,F. Analysis of expressed sequence tags from the ectomycorrhizal basidiomycetes Laccaria bicolor and Pisolithus microcarpus. New Phytol. 159 (1), 117-129 (2003).
DNA ref. JGI genome:   LG_10 (4251152..4249295)
EST ref. GenBank:   CB011448.1
Cluster/Prediction ref. JGI gene:   191903
Protein sequence: LbiCIIBC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (324)
PWM (Da):   %s   35945.83 (33799.6)  
PI (pH):   %s   5.24 (5.24) Peptide Signal:   %s   cut: 22 range:22-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVALFSTLITLLFGAQIANAAGLSNQVTCSTGHVTSNKACCPLFPIVDNIQQNLHGGGACGFGAHTALRLSFHDAIGFSIHGGKGGGADGSILIFNTTELAYDANVGIDDITADQWPVFQTTGLSAGDFLHLAAAVGTANCPGAPRLQYMFGRPPPVAPAPDNTVPKPTDSVDSMLARMADAGFSPAELVALLASHSIANVVDIDPTVAGIPLDSTSTTFDSQLFLEVLLKGTVFPGSGANSGEVQSFTTAEMRLQSDSAIARDHRTACSWQSMINNQARMMTQFKAAMAKLQVLGQDTSKLIDCSDVIPVPKPFAGPIKYPSSFSQANIEQKCTEFKFPSVGR

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns) and 1 EST. The predicted 3' can be shorter than expected (concerved residues are missing)=> more ESTs needed to confirm.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGCGGCCGACGGATGGGAACTTAAACTCAGTGCACTACAGCCATGTTAGAAAAATATGATGGGTCCTAAATATCATGAATATATCATACCTTCTGCTCGATATTAGCTTGAGAGAATG
AGCTTGG
GTACTTGATTGGACCAGCGAAGGGTTTGGGCACGGGTATGACCTGGGTGAAATAAGAGTTGTTGATCAGGACAATTGCTCAATGTTCCTTCAAATAGGACGTACATCGGAGCA
ATCAATG
AGTTTACTTGTATCTTGACCCAGGACTTGGAGTTTGGCCATGGCAGCCTTGAATTGGGTCATCATCCGCGCCTGGTTGTTAATCATTGACTGCCATGAGCATGCAGTTCTGTG
ATCTATTTCCGAAGGTTGAAGCCCGGATACTTCGCAAGAAAAACTCAAAGGACGAACCGCGTGCGATGGCTGAATCACTTTGGAGGCGCATTTCTGCTGTAGTGAAAGATTGAACTTCAC
CACTGTTGGCGCCGGAACTAGGGAAGATATATAGAGTTAGAAACTGTACGGATGTCTGTCAAATAACCACCTACCCTGGGAATACAGTTCCCTTCAGGAGGACTTCAAGGAATAGCTGGG
AGTCGCTAATTACGAACTTATGTTTGAACATACAATGGTCGAAAATTGGATGTCG
GATACTCACAAAGTCGTCGAAGTTCTATTATTCGACGCATAAGTGGAACTCGGACTGAGTTGATG
TGGGGAATGACTCACGAATCTAACGGAATTCCGGCAACAGTCTAGAAAGGGAATGAGTGATAAATCGTGCAGATACAACAGGGTGACGCACTGGGTCAATGTCAACC
TAACAAAAAGAAA
CTTCAATAATTTGCTCCTAGACAAAAAAGCAAAAGACGTACAACGTTCGCGATGCTATGAGACGCGAGGAGAGCCACAAGTTCCGCCGGGCTAAATCCCGCATCAGCCATGCGAGCAAGC
ATGGAATCAACGCTATC
TAGATACGACAGTTTTAGTACGACGAGACACAGAGGTCAATATCAAGGAGTTACCGGTGGGTTTCGGTACGGTGTTGTCAGGAGCAGGTGCCACGGGTGGAGG
ACGGCCAAACATATACTGGAGTCTAGGTGCGCCTGGGCAATTTGCGGTACCAACCGCGGCGGCAAGGTGCAAGCTTTAGATAAAATAGTAAGGTAATGCTCATACTGGAACGGCTTCACT
CACAAATCTCCGGCACTCAGTCCGGTAGTTTGGAAGACTGGCCATTGATCAGCGGTGATATCGTCGATCCTTTGGATTGGTGTCAGAGATAAAATGAAATTTTGGGGATTGAATAGTTAC
CCCACGTTGGCATCTGAAATCATTGTCACGACATCAGGGGACGTCAATATACAGGTCGAAACCAAAAATAATCACCGTAGGCCAACTCGGTGGTATTGAAGATCAGAATTGAACCGTCTG
C
GCCGCCGCCTTTGCCACCTGACCACAAATAATTAGTAGGTAGTTACAAACATTGTTGGTTAGCTACCGTGGATGGAGAACCCAATGGCGTCGTGGAACGACAGTCGAAGAGCTGTGTGC
GCCTGGCAGGGTGATGAGGACAGGGAGAGTGGATGAGGAAAATTCGTACCCCAAACCCACACGCTCC
ACCGCCATGAAGGTTCTGTTGGATATTATCAACAATAGGGAAGAGTGCTGGTG
ACCATTCAAGTCAGTATTCGAAGAGAAAGGGGCACATTTTAGATGACTCACGGCAGCATGCCTTGTTCGATGTAACGTGCCCAGTGCTACAGGTTACTTGGTTGGAAAGACCAGCGGCGT
TGGCGATTTGAGCGCCAAATAAAAGAGTAATGAGCGTGGAGAAAAGAGCGACAGCCAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGCGGCCGACGGATGGGAACTTAAACTCAGTGCACTACAGCCATGTTAGAAAAATATGATGGGTCCTAAATATCATGAATATATCATACCTTCTGCTCGATATTAGCTTGAGAGAATG
AGCTTGG
GAGTTGTTGATCAGGACAATTGCTCAATGTTCCTTCAAATAGGACGTACATCGGAGCAATCAATGTGAATTGGGTCATCATCCGCGCCTGGTTGTTAATCATTGACTGCCATG
AGCATGC
AAACTCAAAGGACGAACCGCGTGCGATGGCTGAATCACTTTGGAGGCGCATTTCTGCTGTAGTGTACGGATGTCTGGAATAGCTGGGAGTCGCTAATTACGAACTTATGTTTG
AACATACAATGGTCGAAAATTGGATGTCG
CGGACTGAGTTGATGTGGGGAATGACTCACGAATCTAACGGAATTCCGGCAACAGTCTAGAAAGGGAATGAGTGATAAATCGTGCAGATAC
AACAGGGTGACGCACTGGGTCAATGTCAACC
ACGTTCGCGATGCTATGAGACGCGAGGAGAGCCACAAGTTCCGCCGGGCTAAATCCCGCATCAGCCATGCGAGCAAGCATGGAATCAAC
GCTATC
GGTGGGTTTCGGTACGGAGTCTAGGTGCGCCTGGGCAATTTTCATACTGGAACGGCGGTGATATCGTCGATCCTTTGGATTGGTGTCAGAGATAAAATGAAATTTTGCGTCAAT
ATACAGGTCGAAACCAAAAATAATCACCGTAGGCCAACTCGGTGGTATTGAAGATCAGAATTGAACCGTCTGC
TGGTTAGCTACCGTGGATGGAGAACCCAATGGCGTCGTGGAACGACA
GTCGAAGAGCTGTGTGCGCCTGGCAGGGTGATGAGGACAGGGAGAGTGGATGAGGAAAATTCGTACCCCAAACCCACACGCTCC
GTCAGTATTCGAAGAGAAAGGGGCACATTTTAGATG
ACTCACGGCAGCATGCCTTGTTCGATGTAACGTGCCCAGTGC
AAGAGTAATGAGCGTGGAGAAAAGAGCGACAGCCAT

Retrieve as FASTA