Entry information : PtroGPx07
Entry ID 6539
Creation 2009-02-05 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-21 (Christophe Dunand)
Peroxidase information: PtroGPx07
Name PtroGPx07
Class Animal glutathione peroxidase    [Orthogroup: Gpx1005]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtroGPx07
start..stop
S start..stop
HsGPx07 390 1e-141 1..187 1..187
MmulGPx07 374 3e-135 7..187 4..184
MmGPx07 353 6e-127 1..187 1..186
RnoGPx07 348 4e-125 1..187 1..185
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53480196..53480333 138 N° 2 53484894..53485155 262 N° 3 53486461..53486624 164  
join(53480196..53480333,53484894..53485155,53486461..53486624)


exon

Literature and cross-references PtroGPx07
DNA ref. GenBank:   NC_006468.2 (53480196..53486624)
Protein sequence: PtroGPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   187 (168)
PWM (Da):   %s   20869.69 (18985.7)  
PI (pH):   %s   8.8 (9.06) Peptide Signal:   %s   cut: 20 range:20-187
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCGGCGACGGTGGCAGCGGCGTGGCTGCTCCTGTGGGCTGCGGCCTGCGCGCAGCAGGAGCAGGACTTCTACGACTTCAAGGCGGTCAACATCCGGGGCAAACTGGTGTCGCTG
GAGAAGTACCGCGGATCG
GTGAGTGCGCGGGGTCTGGCGGCGCCGCGGGGCCTGCTGGGGGCGCCCCGCAGCCCGGTCCCCCGCGCGGTGTGGCTCCGAGGACGCTCCAGCCGCGCTGCC
GCCAAACCCCGGCCCCCGCCCCACTCGGCCGTGACCTCTGGGGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGC
GCGGCGCCCCCATCCCGCGCCCGGCCCGGCCCGGCCCGGCCCGCGGCTACGTGGCACGGCCTTGGCGCGGAGGAACCCGAAGCGCTCGCAGTCGGCGCCCACTTCGCTACCGGCACCTTT
GGGCAGCGGGGTCCAGACCTTCGCCGGGAGGCCGGGCACCACTGCCCAGCCTTTGCCATTCACGGGTGAAAAAAGTAACCGTAGCATCGTGCGGCCTTTCCCTCTCCCGTCCGCATTTTC
TGCATCTGGAACGGGGAGTGGCTGATTCGGAGTCCAGTGAAGAACACTGTGGAGATCAATGTGCAGGGCAGAGGGAGTTATTTCAGATGCATGGAGACCTCACACGGATCATCCTTGGGA
GAGGGCACAAAGGCCCAGAGAGGGCAGGCATTCGCACAAGGTCACACTACACTAGAAAGACGGGGCCTGGAAGAGAACCCCACCGCCACATCTGGGGTCCTCTCTAGGCCAAGTCCTTAG
ATGGCAGCTCAGGGGCACACATAAGAGTCATCCAGGCTAATTGCCCCCTCCTTACCAAGAGGGAATCTAAGCTCAGAGAAGACTTCGGAGAGGAAGGGTATCTGGGTTGAGTCTTTGAAT
ACGAGTGGATTTTAGCAAGACTAAGAAGCAAACAGCAAGAAGGGGTGGGGGGCGCGGGGCCAGGAGTTCCAGCTGTTGTGCTTCAAAGAGTCTAAAGCTGGAGGCTAAGAGTGGTGGAAG
ATGAGGCTGAAACGACTGGCAAGGGAGCAGGCGGGACCTTGAACACTACATTGAGAGGCCTGCATGTCACATTATGTGCAGTGAAGAACTTCCAGAGTGGACCTCTTCGGGATGGACCTG
GGGACTGGTGTGAAATGGCTGGGGAGTTGAAATCTAGTGAACAGGTGGGCCAGCGTCCAGTTTTGGATGAACCACACAAAAATAGATGTCAACATTTTTCTCTTGGGAACAACACCATCT
TTAGTGAAGACCAGTACTCTATAAGCCTTGAAATTTTCGATTTTGCTGGGAGTCTTGGGGGCAGTAATCCCTGTCTTGATTGTCCCCCAGAGTGTCGTGAGTTTCAAATCAGATGAAGGC
GTGAATGCACTTAGTAAACTGTAGAGTGCTTTGCACCTGTGTTTGGTGGATCCCAGCAGGAACTTCATTTAGAACTCTGGGCAAAGAACCAAGAACAGGGCCTGTTCCAATTCAGGCCTC
CTGTTCTCTCAAGGGCAGCTCACCAGAGAGCCCCAGGTTTAGCGTCTGACCAGCTCTGCTACTTATTAATTCGTTGTTCATTATTGAACCCCTACTGTGTACTAACTAGATACTAGGTCA
GGCCCTGGGGATACAGTGGTGAACAAAACAGATACATTTCCACTAAATGGAGCTTACATGGGGTAAGGAGAAGAAAGACAATAAACAAGGAACTGAGAAATGCACAAGGTAATTCCTAGT
AGTAGTAAGTGCTAAGACAAAAATAGAACAAGGTCACACAGCTAGTAAGACAGTTAGAATTTGAACCCAGACAGTCCAGCTCCAGAGTCTATGCTCTTAGTTGCCAAGTTCAGCAGTAAA
CCAGGGAACAGGGAGTCCAGAAAAGCTGTAATTGTTGCTGAGTTAACCCAGGCTAGGCCTGCTACTTGGGCAATATGCTCATTCCTTCACCTGCAAACATTTACTGGCTCCTACTACATG
TCTGACACTGGGTCCAGCTCTGATGACATAGTCATGAGCAAGATTGACATGGTTGATGCCCTCAGGCTAATTGGGACCATAGTCATTTACACCAGTATGGATGAATGGGTGACCACTTGG
GAATGTGTGGGGTTATGTGTAGTGTGTGCGTTTGTGAATGGTTTACTTCTTCTGTGTACAAATCTGAGTCTGTGTCTGTGCTTGTATATGTACATATGTAAATTAACTGTGTGTACTTGG
GTGTGTCTGTCTGTGTTTTGGTTTCTAAGGACCAAGCTTTTTGGTTTCAGGGATGGAAATAGAAGCCAGATTTTCCCCCTTCCAAAAGAGCGGGCAGACATGCAAGTTGTGAGTTAAAAA
TAAGCAAGCTTTGGCCGGACGCAGTGGCTCACGCCTGTAATCCCAGCACTTTAGGAGGCTGAGGCGGGTGGATCACAAGGTGAGGAGTTCGAGGCTAGCCTGGCCAACATGGTGAAACTC
CGTCTGTACTAAAAAAATACAAAAATTAGCTGGGCATGGTGGCGTGTGCCTGTAATCCCAGCTACTCAGGAGGCTGAGGCAGGAGAATTGCTTGAACCCGGGAGGTGGAGGTTGCAGTGA
GCCAAGATCGCGCCACTGCACTCCAGCCTTGGTGACAGAGCAAGACTCTGTCTTTAAAAAAAAAAAAAAAAAAAAAAAGCTTTAATGTTCTCATTGCCCAGGGATTCAGCAGGGGGAAAA
AAAGGAAGAACTCTAACTGAGGAAGGGAGTTAAGAGTCCCAGTTTCTCCCCATTCCAGGCACAGTATGGTGTATGCTGACCTCAAATTGAGGAGGGTGTTCTAATAGCCAGTGGCCCCAG
GCATGGGTCCTTTCTCACCTGGTGGAGGTAGGGTACAGGAGGTACAGCTCAGTGGTTCAATCACCTAGCCCAGTAGTTCTCAACTAGGAGTGATTATTCCCTTTAGGGCACAATTGGCAA
TGTCTGGAGACATTGTTGATTGTCAAGACTGGGCATCTAGTGGGTAGAGGCCAGGGATGCTGCCAAACATGTGATAATAAATAAACAGGACATCCCCCTGACAACAAAGAATTATCTGAC
CCAAATGTCAATTATGGAGGATAGGGCTAGGCTGCGTAGGCACCGGGTAGGGTTTTAAATCCATTAATAATATATACCTAGAAGCTAAAAACATAGCATTTGAGCCAAAATTCTAATCAA
AGTCCTGTAATCAAGTTCCATTAGCCAGCTTTGTATTTATTGCCTAAAGGCTTTAATAAATTTAAGGATTAGTCTAATGATAAAAGAAAGTGGTAGGCTGGGCATGGTGGTTCATGACTG
TAATCCTAGCACTTTGAGAGGCTTAGCTGGTAGGATTGCCTGAGGCTAAGAGTTTTTGAGTCCAGCCTGGACAACATGGCGAGAACTGTCTCTACCAAAAGTAAAAATTAAAAAATTAGC
CAGGTGTGATGGCACGTGCCTGTAGTCCTAGCTATTTGAGAGGCTGAGGTGGGAGGATCACTTCAGCTCAGAAGTTTGAGACTGCAAACGGTTGGGGGGATGTCCTGTTATGATTATGCC
ATTGCTCCAGCAACAACAACAACAAAAGTGGTGTGTGTTCTCTGGAGAGGAGGGGGACAAAAAGGTGATTGCCCTGGGGTTATGAGGGTTCTTTTCTCAAGAAAACCTGTGTCTGTCTAT
GTTCCCATGCAGGCGTTTGTGTTTGTGTGCACACTTACTCATTCATCTGAAACTTACTGAGACTTTTTCATATGCCAGGCCCAGAGATGAAGTGGACATAGCTCCTGCCCTCAGTAGGTT
CACATTCTAGAAGGGAGACTGACACATTGCAGAGTGGCGAGTGCTAGCTGACTGAGCCAAAAATTGAGCCCAGGTCTCCCTTTGTACCCCCTCTTATCAGTTCTCAGTACGTGCTCACCA
GTATGTGTGCCCCAGTCTGTGGATGTGCTGTGTGTGTGGGCACGTGTGGTGTTTGCTAACATATGTTTGTATTGTGGTGCATGTGCATACCTATTTATGTATGTTGTATACTTATGTTCA
CAGATGTTCATGTATGTGTGCACACATCTGTAAGCTCCTGAATGTTTGATTTCATATGTGCCTGTCTGTGTGCATGTGTTTGTGTATGTGTGAGAGCACTGGACACACATTTACATATGT
GTACACAGTGTTCTTGTATGTGTGAGGCAGTATTAACTGTTGAGGGAGTCACATATGTGGATGTGTCAGGGCATGTACAGGTTCATGCCTCTTCACTGGCTTGTCTGGGCTTTGTTTTGT
TTTGTTTCTGTCATACAGGTGTCCCTGGTGGTGAATGTGGCCAGCGAGTGCGGCTTCACAGACCAGCACTACCGAGCCCTGCAGCAGCTGCAGCGGGACCTGGGTCCCCACCACTTCAAC
GTGCTCGCCTTCCCCTGCAACCAGTTTGGCCAACAGGAGCCTGACAGCAACAAGGAGATTGAGAGCTTTGCCCGCCGCACCTACAGTGTCTCATTCCCTATGTTTAGCAAGATTGCAGTC
ACCGGTACTGGTGCCCATCCTGCCTTCAAGTACCTGGCCC
GTAAGTCCTGGTCTCTTCATCCCCTCACACCTCCCTCAGCTGGCTGAGGCCATGGCTCCCTGGGCAGCAGAAGCCACGGG
CTGGTTGGGTGACCTGGGGCCCCTTCCCCTTCCTGATCATCTCAGGTAGACTGATGCTTTGTTCCAGCACTAATCTTTGAGGAGAGTGGAGGCAGGTACAAGCTGAGGGGTATTCCTGCC
TAAGAATATCTCCATACCTGCTGCCTCTCACTTGTCCCTCAGAAGTCACTCTTTTGGACTTTTCCGGGATCCTGTTTTCACATTCAGGGGCTCCTAGAAGGAGACATTTAAGTCAGTGTG
AACTAGATGAGTTTATGGACATACGATGGAGAAACCAAGGCATAGACAGGGGAGGCCACGTGCTTGGAGAAAGCTGACCAAGATAGTGGACAGGCATCTTCACCCTGAGTCAGTGGCGGA
GTCTGTAGGCCATGGAGGGAGACCTTCTAAGCTAAAATACCAGATCTTAGTATTTGAGAACAAGATCCCTTCTCCAGCTGCAGAAGCCTCAGAGCCACAGAATGGGGTCATGGGCTAAGC
TTGCCATTCTGACCATTTCTTCACTCAGGCCTTCTCCTTTGGAGGCCCCATTTTTGCCTTTTCTGATTCCGTGCTTCTGGTGGCCTTTGTATCCCTTGCCACCACCCCACCCTGCAACCC
ATTCACCTGGAGGAGTAAATGAGAAGCAACAGTGCAGCAAACAAAAGGTCCCTTACTGCGGCAGGTTTGTGTTTTGCTCTGTGGCTCAGTCCTAATGTTTATTTTTTTCTCTGTGTTCTT
TTATTAGTTCCTTCCCAGTTCTCACAGTTATAGATCAAACCCAGCCTTGCTTTTAGAAGCACCTGGGGAGCTCTTAAAAATGCACAAGGCTGAGACCTACTGAAGCAGGGCCCAAGAATC
TTTATTTTAAGCACTCCCCTGACCCCCAGTGATTCTGATGAAACCAGTCCATTGGAAACCATTAAAACTGAATTAGAGAATAGGGTGTAGACTATTCAGTAGTTCAAAGTCATTAATAAA
GGAGGATTTGATACCACTTTATCAAGCACGTCACAGAATCCTACAGCAGTCATTCTCAACCTTGGCCCCACTTTGGAATCTCCCAGGGGGCTTTTGAAAAATGCTGATGCCTGAGCCTCA
TCCTCAGAGATTCTGGTTGGAGTGGTCTGGGGTGTGGACTGGGCATCAGGATTAGCTGCCACCAGGGAAAGATGGACACTGAGAGTGAAGTCCCAGGAGAGGGTACGCGGGGTAGCACAC
TTTGCTCTCCTTCCTTTTTCTCTAGAGACTTCTGGGAAGGAGCCCACCTGGAACTTCTGGAAGTACCTTGTAGCCCCAGATGGAAAGGTGGTAGGGGCTTGGGACCCAACTGTGTCAGTG
GAGGAGGTCAGACCCCAGATCACAGCGCTCGTGAGGAAGCTCATCCTACTGAAGCGAGAAGACTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCGGCGACGGTGGCAGCGGCGTGGCTGCTCCTGTGGGCTGCGGCCTGCGCGCAGCAGGAGCAGGACTTCTACGACTTCAAGGCGGTCAACATCCGGGGCAAACTGGTGTCGCTG
GAGAAGTACCGCGGATCG
GTGTCCCTGGTGGTGAATGTGGCCAGCGAGTGCGGCTTCACAGACCAGCACTACCGAGCCCTGCAGCAGCTGCAGCGGGACCTGGGTCCCCACCACTTCAAC
GTGCTCGCCTTCCCCTGCAACCAGTTTGGCCAACAGGAGCCTGACAGCAACAAGGAGATTGAGAGCTTTGCCCGCCGCACCTACAGTGTCTCATTCCCTATGTTTAGCAAGATTGCAGTC
ACCGGTACTGGTGCCCATCCTGCCTTCAAGTACCTGGCCC
AGACTTCTGGGAAGGAGCCCACCTGGAACTTCTGGAAGTACCTTGTAGCCCCAGATGGAAAGGTGGTAGGGGCTTGGGAC
CCAACTGTGTCAGTGGAGGAGGTCAGACCCCAGATCACAGCGCTCGTGAGGAAGCTCATCCTACTGAAGCGAGAAGACTTATAA

Retrieve as FASTA