Entry information : Ptro2CysPrx02-1 (PRDX2 / Ptro2CysPrx02-1)
Entry ID 6551
Creation 2009-01-29 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-21 (Christophe Dunand)
Peroxidase information: Ptro2CysPrx02-1 (PRDX2 / Ptro2CysPrx02-1)
Name (synonym) Ptro2CysPrx02-1 (PRDX2 / Ptro2CysPrx02-1)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type Brain
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ptro2CysPrx02-1
start..stop
S start..stop
Mmul2CysPrx02 407 5e-148 1..198 1..198
Mfa2CysPrx02 407 5e-148 1..198 1..198
Hs2CysPrx02 407 5e-148 1..198 1..198
Ggo2CysPrx02 407 5e-148 1..198 1..198
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13166302..13166404 103 N° 2 13166059..13166212 154 N° 3 13165320..13165442 123 N° 4 13165002..13165132 131
N° 5 13162829..13162914 86  
complement(join(13162829..13162914,13165002..13165132,13165320..13165442,1316605 9..13166212,13166302..13166404))


exon

Literature and cross-references Ptro2CysPrx02-1 (PRDX2 / Ptro2CysPrx02-1)
Literature Hellmann,I., Zollner,S., Enard,W., Ebersberger,I., Nickel,B. and Paabo,S. Selection on human genes as revealed by comparisons to chimpanzee cDNA. Genome Res. 13 (5), 831-837 (2003).
DNA ref. GenBank:   NC_006486.2 (13166404..13162829)
mRNA ref. GenBank:   XM_524127.2
EST ref. GenBank:   CB294573.1
Protein sequence: Ptro2CysPrx02-1 (PRDX2 / Ptro2CysPrx02-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198
PWM (Da):   %s   21764.2  
PI (pH):   %s   5.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 19, 4 introns) and 5 ESTs. Isolate="Yerkes chimp pedigree #C0471 (Clint)".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGGTAACGCGCGCATCGGAAAGCCAGCCCCTGACTTCAAGGCCACAGCGGTGGTTGATGGCGCCTTCAAAGAGGTGAAGCTGTCGGACTACAAAGGTGAGCGCCGCCCGGAG
GGGGCCCAGGTAGAAGCGGGGCCGTGCATGAGAGAAGCTGGGCCCTAACTCCTCTGTGTCCCTCCTCCCCAGGGAAGTACGTGGTCCTCTTTTTCTACCCTCTGGACTTCACTTTTGTGT
GCCCCACCGAGATCATCGCGTTCAGCAACCGTGCCGAGGACTTCCGCAAGCTGGGCTGTGAAGTGCTGGGCGTCTCGGTGGACTCTCAGTTCACCCACCTGGCTTG
GTATGAGCAGGGGC
CAAAGAGGGAGGTTGCAGCTAAGCTCACACCCTCGGGTCCCAGCTGTGTGGCTTCGTGGCCATTGCTCAACCTCTGGAACCTGCGTTTCCCCATCGTGAAAATAATGGAAACATCTCCCG
CCAAGTCTTTAAGGATGATGACAGTAATTAGCATTTGACAACTAGTTGCCTGGCATATAGAGTTGCAGATGCAACTCAGATGCAACTCTATCTACTCTATCTACTTAGTTCCCAGGAGGG
AGGCTGTGCTGCCCTATTTCATGAAGATGGAAACTCCAGTTCACCGAAGTGAAGGGCTGTACCCCATGACACAGCTAGAGGAGGATGGGGACTCTTAACACGGGCTCTCTGCTGGGTGAT
GCTGCAAGTTACAAGCACATGTGAAGCCACTTAGCTGGAGCTGTGCCTCTCAAACTCAGTCTTCCCAGCCGTGGGGATACAGTCCTTGCACCCAACCCAGGGTGGGGTGGGTGAGGCTCC
CAGCAGCCTACTCTAAAGCCCCTTATCTCTGGCCTCCAGTGCTTATCACATTGGGCCCACAGGGTGAGGACCCTGCTGTGCCAGGCATCCTGAGGCCCCAACTCTGTCTCCCCTACTCCC
AGGATCAACACCCCCCGGAAAGAGGGAGGCTTGGGCCCCCTGAACATCCCCCTGCTTGCTGACGTGACCAGACGCTTGTCTGAGGATTACGGCGTGCTGAAAACAGATGAGGGCATTGCC
TACAG
GTACTGTGGGACCCTCAGCCCGGCTCAGGGAGCGCCCTGCCCCCCATTCCTGTGATGCTGGGACCACTCCTGTACAATGTCTTCTCTGCCCCCAGCCCTGTGGCTAGCAGCGGGT
GGTTGGTAGTCCCTTCCTTGTCTCTGGCAGTGGGAGCTACCAGCTCCTCACTGGGAACCCTGATGTCTTCAGGGGCCTCTTTATCATCGATGGCAAGGGTGTCCTTCGCCAGATCACTGT
TAATGATTTGCCTGTGGGACGCTCCGTGGATGAGGCTCTGCGGCTGGTCCAGGCCTTCCAGTACACAGACGAGCATGGGGAAG
GTGAGCAGATACACACAGGACACATGGGTACATACTG
AGCGCCTCCGTCACTCATGCAAACATTCACTGCCTGTCCTCTTACCTGTCCAGATGGGTGTTAGGGCCCCAAAGAAGATTCAGCTCAGGGCTTTGTCTGCAGGATGTTTCTAATGTGGTA
GGAGACAAATAATGCCTGACATTCAACCAAGGTGGACAAAGGGGCTGGGCTCAGTGGCTTACGGTTGTAATGCCAGCACTTTGGGAAGCTGTGGCAGGTGGATCACCTGAGGTCAGGAGT
TCGAGACCAGCCTGACCAACATGGTGAAACCCCGTCTCCACTAAGAACACAAAAAATTAGCTGGGCGTGGTGGCGCACACTTGTAATCCCAGCTACTTGAGAGACTGAGGCAGGAGTTCG
CTTGAACCCAGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCATTGTACTCCAGCTTGGGCAACAGAGCAAAACTCAGTCTCAAAAAAAAAAAAAAAAAATTAGCTTGGTTTGTGAAG
CATGCCTATAGTCCCAGCTACTCAGGAGGCTGAGGCTGGAGGATCACTTGAGCCTGGGAGGTCAAGGCTGCAGTAAGCTGTGATCGCACCACTGCACTCCAGCCTGGGCGCCAGTGTGAG
ACTCCATCTCAAAAACAACAACAACAAAAAAGCCTGTAGGGGTGGGGCAGAGGGACAAAGATGGGATTAAAGGAGCCAAAAAGACAGGAAGATGCTGTGTCTCATGCCTGTAGATAGTTC
CACCTACTCTGGAGAGTGAGGCAGAAGATTGCTTAGGCCCAGGAATTTGAGTCGAGCCTAGGCAACATAGCAATACCCCATCTCTTTTTTTTTTTTTTTTTTTTTAAGAGATGGGGTATT
GGTCAAAAAAAAAAAAAAAAAAAAAAGAGGCCAGATGCAGTGGCTCACACCTGTAATCCCAGCATTTTGGGAGGCCTAGGCGGGTGGATCACCTGAGGTCGGGAGTTCGAGACTAGCTTG
ACCGACATGGAGAAACCCCATCTCTACTAAAAATACAAAATTAGCCCAGCCTGGTGGTGCATGCCTGTAATCCCCGCTACTTGGGAGGCTGAGGCAAGAGAATCGTTTGAAGCTGAGAGG
CGGAGGTTGCAGTGAGCTGAGATAGCGCCATTGCACTCCAGCCTGGGCAACAGAGCAAGACTTCATCTTAAAAAAAAAAAGAAAAGAAAAAAAGAAGAAAAAGGAGAGCTGGGTGGCAAA
AAGAAATTGAAGAATTAAGAGTACGAAAAACACCAGCTAGAAAATACTGAACTTGGCCAGGTGTAGTGGCTCACGCCTGTAATCCTAGCACTTTGGGAGGCCAAGGTGGGTGGATCACCT
GAAGTCAGGAGTTCGAGATCAGCCTGACCAATATGGTGAAACCCTGTCTCTGCTAAAAGTACCAAAAAATTAGCAGGGTGTGGTGGCGGGCACTTGTAGTCCCAGCTACTCAGGAGGCTA
AGGCAGGAGAATCACTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCCGAGATCACGCCATTGCACTCCAGCCTGGGCAACAGAGCAGGACTCTGTCTCAAAAAAAAAAAAAAGAAAGAAA
AAAGAAGAAAAGAAAAAGAGAAACTACTGAACTTGGCTAGGCATGGTGGCTCACACCTGTAATCCCAGCACTTTGGGAGGCCAAGACGGGCAGATGACTTGAGGTCAGGAGTTCAAGACA
AGCGTGACTAACATGGTCTCTACCAAAAATACAAAAATTAGCCAGGCGTGGTGGTGCACCCCTGTAATTCCAGCTACTTGGGAGTCTGGGGCATGAGAATCCCTTGAACCCAGGAGGGAG
AGGTTGCATGAGCTCAGATCATGCTACTGTACTTCAGCCTGGGCAACAGAGCAAGACTCTGTCTCAAAAAAAAAAAGAAAAAGAAAAAGAAAAAATACTGAACTGGGCTTGGAGGGCTTA
TCTTAATATCCACATTCCTGGTCCTGGACCACTTGCTTCCAGCATTTTCTTCTGCAACACAGGCCCTTGCTTTGCTTCACCTTGAACCTGGGGCTGTAGCCTTCATGTGCATCCTTGTGT
CTTCCCACAGTTTGTCCCGCTGGCTGGAAGCCTGGCAGTGACACGATTAAGCCCAACGTGGATGACAGCAAGGAATATTTCTCCAAACACAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGGTAACGCGCGCATCGGAAAGCCAGCCCCTGACTTCAAGGCCACAGCGGTGGTTGATGGCGCCTTCAAAGAGGTGAAGCTGTCGGACTACAAAGGGAAGTACGTGGTCCTC
TTTTTCTACCCTCTGGACTTCACTTTTGTGTGCCCCACCGAGATCATCGCGTTCAGCAACCGTGCCGAGGACTTCCGCAAGCTGGGCTGTGAAGTGCTGGGCGTCTCGGTGGACTCTCAG
TTCACCCACCTGGCTTG
GATCAACACCCCCCGGAAAGAGGGAGGCTTGGGCCCCCTGAACATCCCCCTGCTTGCTGACGTGACCAGACGCTTGTCTGAGGATTACGGCGTGCTGAAAACA
GATGAGGGCATTGCCTACAG
GGGCCTCTTTATCATCGATGGCAAGGGTGTCCTTCGCCAGATCACTGTTAATGATTTGCCTGTGGGACGCTCCGTGGATGAGGCTCTGCGGCTGGTCCAG
GCCTTCCAGTACACAGACGAGCATGGGGAAG
TTTGTCCCGCTGGCTGGAAGCCTGGCAGTGACACGATTAAGCCCAACGTGGATGACAGCAAGGAATATTTCTCCAAACACAATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGACGGGAG GACCCCCTTC AGGCTGCTTT GGCCCGATCC TGACTTTAGT GCTGGCCGCC TTTGCTTTCC ATCCGCTATA GTGGCCTCCT TTGTCCTTGC GGGGGAAACC GAGGCCACAG  CCTTGCAGCG CAGGCCGGAT CGCCCGAATC CCCGCCCCCT GCTCGTGCGG GCCTCACTGT CTCCTTTTGG GCTGGGGGCT TGCGACACCG CCCTCCGGCC GACTCGCTCG TGGGGTGCTG  GTGGCAGTGG CTGGGTCACT CGTGCTCTGG TCAGGAGAGC GGGTCTCCGG CAGCCTCCGG GCCTCGTAGA CCGGGTACCC GGGAGGGTGA GGGTTAGTGC TGTCGCCTCC GCCGTGCTGA  CTCAGTCACA GGGCCCAGCA CGCAGCGCGA CCTTGGGTTG GGAGGACAAA GTGTCTTCCC GGGCGCACTG ACCGGGCGGG GGTCTCAGCT TTCAGTCATG GCCTCCGGTA ACGCGCGCAT  CGGAAAGCCA GCCCCTGACT TCAAGGCCAC AGCGGTGGTT GATGGCGCCT TCAAAGAGGT GAAGCTGTCG GACTACAAAG GGAAGTACGT GGTCCTCTTT TTCTACCCTC TGGACTTCAC  TTTTGTGTGC CCCACCGAGA TCATCGCGTT CAGCAACCGT GCCGAGGACT TCCGCAAGCT GGGCTGTGAA GTGCTGGGCG TCTCGGTGGA CTCTCAGTTC ACCCACCTGG CTTGGATCAA  CACCCCCCGG AAAGAGGGAG GCTTGGGCCC CCTGAACATC CCCCTGCTTG CTGACGTGAC CAGACGCTTG TCTGAGGATT ACGGCGTGCT GAAAACAGAT GAGGGCATTG CCTACAGGGG  CCTCTTTATC ATCGATGGCA AGGGTGTCCT TCGCCAGATC ACTGTTAATG ATTTGCCTGT GGGACGCTCC GTGGATGAGG CTCTGCGGCT GGTCCAGGCC TTCCAGTACA CAGACGAGCA  TGGGGAAGTT TGTCCCGCTG GCTGGAAGCC TGGCAGTGAC ACGATTAAGC CCAACGTGGA TGACAGCAAG GAATATTTCT CCAAACACAA TTAGGCTGGC TAACGGATAG TGAGCTTGTG  CCCCTGCCTA GATGCCTGTG CTGGGTGTCC ACCTGTGCCC CCACCTGGGT GCCCTGTGCT GACCCAGGGA AGGCCAGACC TGCCCCTCCA AACTCCACAG TATGGAACCC TGGAGGGCTA  GGCCAAGGCC TTCTCATGCC TCCACCTAGG AGCTGAATAG TGACGCCCTC CCCCAAGCCC ACCCAGCCGC ACACAGGCCT AGAGGTGACC AATAAAGTAT TAGGGAAAGG TGTGACCTCC 
CAAACAAAAA AAAAAAAAAA AGAAAGAAAC AAAGATGGTC AGGCAGACAA AAG 

Retrieve as FASTA