Entry information : CcinPrxII
Entry ID 6555
Creation 2009-01-30 (Christophe Dunand)
Last sequence changes 2009-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: CcinPrxII
Name CcinPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinPrxII
start..stop
S start..stop
LbiPrxII 254 2e-88 4..171 2..169
AthiPrxII 251 8e-87 5..171 6..172
HcyPrxII 245 1e-84 4..171 2..171
SlutPrxII01 243 7e-84 2..171 3..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1729124..1729207 84 N° 2 1729021..1729036 16 N° 3 1728886..1728956 71 N° 4 1728610..1728756 147
N° 5 1728388..1728525 138 N° 6 1728269..1728328 60  
complement(join(1728269..1728328,1728388..1728525,1728610..1728756,1728886..1728 956,1729021..1729036,1729124..1729207))


exon

Literature and cross-references CcinPrxII
Literature Birren et al., The Broad Institute Genome Sequencing Platform. Annotation of the Coprinopsis cinerea genome.
DNA ref. JGI genome:   Chr_12 (1729207..1728272)
Protein sequence: CcinPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18433.6  
PI (pH):   %s   6.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSATIKVGDAIPEATFKYIPWTEALENNLACGSPVELSTNDWKNKKVVIVSVPGAFPTCHTNHLPPFLQKYDEFKKKGVDVIAVLAANDPFVMSGWGRFEGLKDKILTISDTNAEWSKKLGLEKDLSAHGLGIRTARYAIILENNVVKYLGVESGPGVTVSGADAILQNL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCAACTATCAAAGTCGGCGATGCCATCCCTGAAGCTACTTTCAAGTATATTCCCTGGACTGAGGCTTTGGAAAACAACGTGCGTTTGTATGTTCTGTCCGCCGCCACTTGGAAG
CTTACGCGTCGGCCCCTTCGAATTACATTGACTCTTTCCCCCTCTCGTTAGCTTGCCTGTGGATCCCGTAAGTACCTCCGTCCACGCCCAGTACATCGCCTTGTCCAGAAGCGAACTAAC
GCCCTTTCCAGCCGTCGAGCTCTCTACCAATGACTGGAAGAACAAGAAAGTCGTGATTGTTTCTGTCCCCGGTGCATTCACCGTACGTTTTCTCCCTTCAAAAAATATACTCGCCTCTAA
TATATTCTCTCTAACGCACGCCCGCCACCACGCCATTTGCTACCCCTATCCATATGAACACCGTCTCTTTGCCGTTGAAAACGGTTTATAGCCCACCTGCCATACCAACCACCTCCCGCC
TTTCCTCCAAAAGTATGACGAATTTAAGAAGAAAGGGGTCGACGTTATCGCCGTCTTGGCCGCCAATGACCCCTTCGTCATGAGTGGATGGGGTCGCTTCGAGGGACTTAAGGACAAG
GT
GGGCATTCATGTTCTAACCTATGTGATTCATTGGCGTCCCGCCAAGGCGCACTACTAACGCTCAGATTTCTTCATTATCTAGATCCTGACCATCTCCGATACGAATGCTGAGTGGTCGAA
GAAATTGGGTTTGGAGAAAGACCTTTCCGCCCACGGTCTCGGAATTCGCACTGCTCGATATGCGATCATCCTGGAGAACAACGTGGTCAAGTACCTTGGC
GTAAGTAGCCTTGCGCATTG
TACCAGTTGGCAGATCATCTGCTAAACGTTTGGCTTCAGGTCGAGAGCGGTCCTGGAGTCACTGTCTCCGGAGCTGATGCTATTCTCCAGAATCTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGCAACTATCAAAGTCGGCGATGCCATCCCTGAAGCTACTTTCAAGTATATTCCCTGGACTGAGGCTTTGGAAAACAACCTTGCCTGTGGATCCCCCGTCGAGCTCTCTACCAAT
GACTGGAAGAACAAGAAAGTCGTGATTGTTTCTGTCCCCGGTGCATTCACC
CCCACCTGCCATACCAACCACCTCCCGCCTTTCCTCCAAAAGTATGACGAATTTAAGAAGAAAGGGGTC
GACGTTATCGCCGTCTTGGCCGCCAATGACCCCTTCGTCATGAGTGGATGGGGTCGCTTCGAGGGACTTAAGGACAAG
ATCCTGACCATCTCCGATACGAATGCTGAGTGGTCGAAGAAA
TTGGGTTTGGAGAAAGACCTTTCCGCCCACGGTCTCGGAATTCGCACTGCTCGATATGCGATCATCCTGGAGAACAACGTGGTCAAGTACCTTGGC
GTCGAGAGCGGTCCTGGAGTCACT
GTCTCCGGAGCTGATGCTATTCTCCAGAATCTCTAG

Retrieve as FASTA