Entry information : LbiPrxQ01 (LbPrxQ1)
Entry ID 6557
Creation 2009-01-30 (Christophe Dunand)
Last sequence changes 2009-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiPrxQ01 (LbPrxQ1)
Name (synonym) LbiPrxQ01 (LbPrxQ1)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiPrxQ01
start..stop
S start..stop
HcyPrxQ 265 6e-92 1..160 1..160
CcinPrxQ01 223 5e-76 2..165 3..166
PplPrxQ01 204 2e-68 6..161 5..159
PcPrxQ 203 4e-67 6..162 7..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 753527..753656 130 N° 2 753424..753474 51 N° 3 753276..753373 98 N° 4 753106..753227 122
N° 5 752948..753056 109  
complement(join(752948..753056,753106..753227,753276..753373,753424..753474,7535 27..753656))


exon

Literature and cross-references LbiPrxQ01 (LbPrxQ1)
Literature Martin et al., The genome of Laccaria bicolor provides insights into mycorrhizal symbiosis. Nature 452 (7183), 88-92 (2008).
DNA ref. JGI genome:   LG_4 (753656..752948)
mRNA ref. GenBank:   XM_001875746
Cluster/Prediction ref. Genebank:   6071410
Protein sequence: LbiPrxQ01 (LbPrxQ1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18624.4  
PI (pH):   %s   4.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSYQSLIGKPAPPITLKNYDGEDYTFTPGATGLPTALFFYPESGSMGCTRQACQFRDAIAEKDTFKPGKVQIIGISPDPVEKQKAFVEKERLYPVLSDVDKEVFKTYGIPKGMYGFVAVARVTFIVDKKGVVRDALDATMNYGAHSKFVEKWLDKLDGEEELEGTETA

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTACCAGTCCCTCATTGGCAAGCCTGCGCCCCCGATTACACTGAAGAATTACGATGGGGAAGATTACACCTTCACCCCAGGCGCTACGGGGTTGCCCACTGCGCTCTTCTTTTAC
CCAGAATCAG
GTACCGTCTATGAGCCGTAGTTTGAGATTCACGCGATCGACGTTGAAAACAGGCTCAATGGGGTGCACACGACAAGCATGCCAGTTCCGCGATGCTATAGCTGGTTGGTA
CAGCCTACTACACGGACAACGATCTATTCTGACGTCTGATCAGAGAAAGATACTTTTAAGCCTGGAAAAGTGCAAATCATCGGTATCAGTCCCGATCCTGTTGAGAAACAGAAAGCATTT
GTTGAGAAGGAACGGTTAACG
GTGAGATCCCGGCAATCTGATATATTGGCATTCTGACTTTGATGATAGTACCCAGTACTGAGTGATGTCGACAAGGAAGTGTTCAAGACGTATGGAATC
CCCAAGGGCATGTACGGGTTCGTTGCGGTTGCGCGTGTGACGTTCATCGTTGATAAGAAGGGGGTAGTCAG
GTTTGTGTTCGTTCAAATCATGAACGAGGTTGACTGAAATGGTAAACAG

AGATGCGCTGGACGCGACGATGAACTATGGTGCTCATTCGAAGTTCGTTGAAAAGTGGTTGGATAAACTGGACGGAGAAGAAGAACTTGAAGGGACAGAGACTGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTACCAGTCCCTCATTGGCAAGCCTGCGCCCCCGATTACACTGAAGAATTACGATGGGGAAGATTACACCTTCACCCCAGGCGCTACGGGGTTGCCCACTGCGCTCTTCTTTTAC
CCAGAATCAG
GCTCAATGGGGTGCACACGACAAGCATGCCAGTTCCGCGATGCTATAGCTGAGAAAGATACTTTTAAGCCTGGAAAAGTGCAAATCATCGGTATCAGTCCCGATCCTGTT
GAGAAACAGAAAGCATTTGTTGAGAAGGAACGGTTAACG
TACCCAGTACTGAGTGATGTCGACAAGGAAGTGTTCAAGACGTATGGAATCCCCAAGGGCATGTACGGGTTCGTTGCGGTT
GCGCGTGTGACGTTCATCGTTGATAAGAAGGGGGTAGTCAG
AGATGCGCTGGACGCGACGATGAACTATGGTGCTCATTCGAAGTTCGTTGAAAAGTGGTTGGATAAACTGGACGGAGAA
GAAGAACTTGAAGGGACAGAGACTGCATAA

Retrieve as FASTA