Entry information : PtroGPx04
Entry ID 6571
Creation 2009-02-04 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-28 (Christophe Dunand)
Peroxidase information: PtroGPx04
Name PtroGPx04
Class Animal glutathione peroxidase    [Orthogroup: Gpx1002]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtroGPx04
start..stop
S start..stop
HsGPx04-A 411 2e-149 1..197 1..197
PpyGPx04-A 410 4e-149 1..197 1..197
MnemGPx04 409 7e-149 1..197 1..197
MmulGPx04 409 7e-149 1..197 1..197
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1062785..1062868 84 N° 2 1064014..1064108 95 N° 3 1064194..1064338 145 N° 4 1064518..1064669 152
N° 5 1065098..1065122 25 N° 6 1065256..1065315 60 N° 7 1065396..1065425 30  
join(1062785..1062868,1064014..1064108,1064194..1064338,1064518..1064669,1065098 ..1065122,1065256..1065315,1065396..1065425)


exon

Literature and cross-references PtroGPx04
Literature Chimpanzee Sequencing and Analysis Consortium. Initial sequence of the chimpanzee genome and comparison with the human genome. Nature 437 (7055), 69-87 (2005).
DNA ref. GenBank:   NC_006486.2 (1062785..1065425)
Protein sequence: PtroGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197 (172)
PWM (Da):   %s   21862.96 (19373.5)  
PI (pH):   %s   8.48 (8.05) Peptide Signal:   %s   cut: 26 range:26-197
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ*GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 19, 6 introns) and 3 ESTs (DC522068, DC522762, DC523771).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCTCGGCCGCCTTTGCCGCCTACTGAAGCCGGCGCTGCTCTGCGGGGCTCTGGCCGCGCCTGGCCTGGCCGGGACCATGGTGAGCGAGCGCCGCGGCCGTTGCCGGCCCGGTGAC
CATTGGGGCGGGCGCGCGATCCCTGCCTCCGCTCGCCGGCGCGGGGAACCCTCGGGCTCCGGTGACCTTGGTGGGGGGCGTCTGGGGGCTCCCCCTCCACACCCCCGGCCGGGCGCGGAC
GCGGGTGACCGTACTGCGACGCGCTCCGCGGCCCTCCAGGCCGTTGTAGGCGCGCGGGCTGGGTTCGGGGAAGGGGAAGGGGCAGTTCAATGCGCGCGCGTTGGGGTCGGGGAAGGGACT
GTTCAGGCCGTTGCGGGCGCGCGGGCTGGGGTCGGGCAAGGGGAAGGGGCTGTTCCACGCGCGCGGGTCGTGGTCGGGGAAGGGGCCGTCCAGGCCGTTGCAGGCGCGCGTGCCGGGGCC
GGGGGCGGGGGTCCAGGCTTGCAGGGGGCGGGGTCCGGGACGGCTGGGGCGGAGCTGGACCGTTGAGGGCCACGGCGGGGCGTCTCCGGGCCGAGCGGGGCTGCTGCGCCCGAGCGGTTG
GGGGCGCGAAGGGCTGGAAATCCCGGATCACGCGCCCCCGGGCGCCGCCCCGCCCCCGCACCTTGGCCTAGCGCGGTGGCGTCACAGTCGCGCAGTCCTGACTACGGCCTCCGGGCCCTT
TGTCCCCGGTAGCGGCGCTCGGGGTGGGGGAGCCAGGAGGGGCGGGAGACGGGCGGGTATGGGCCGCGCGGGCGCACGCTCCCCCGGGCGCCGCAGGCAGCGGTGCCAGAGCCGGGGCAG
GCGGCGGCCGCGAGCCCCTCGGCGGCGGAAGGCCCCAGCGTGCAGGCGCAGGAGGGCGCGGCGCCGGCGGAAGAAGCCCTGTCCCCGCAGCTTGCGACCGGAGATCCACGAATGTCCCGA
GTCCCAGGACCCGGTGCGCGCGGGGCCCCCACACCGGCTGCTGTGGCACATTTTGGGGTTGGAACCCTCTCCCGGCCTCCGGGTCTCCGGTAAAACCGGACCAGAAGTACAAGGGGGCGT
GTGCGTTTAAGGAGGAGGAGCGTTCAGGTTTTCAGGGCCGCAGGGCCTCGGTGTCCCCGCCACCGACCCGCTCCCGATCCCTTCCTGCCTCAGGGTCCCGGGCTCAGCCTCCCGTCCACG
CTCCCTGCTCAGCTTCCTTTACCTTGCAGTGCGCGTCCCGGGACGACTGGCGCTGTGCGCGCTCCATGCACGAGTTTTCCGCCAAGGACATCGACGGGCACATGGTTAACCTGGACAAGT
ACCG
GTGGGCGCTCGCCTGGGGTGGGGCGCGGGGCCGGGCCCTGGGAGGGGGCCGTGTTGTTCTGCGCTGACGCCGCCGATCCTCGCAGGGGCTTCGTGTGCATCGTCACCAACGTGGCC
TCCCAGTGAGGCAAGACCGAAGTAAACTACACTCAGCTCGTCGACCTGCACGCCCGATACGCTGAGTGTGGTTTGCGGATCCTGGCCTTCCCGTGTAACCAGTTCGGGAAGCAG
GTGGGC
TGCTGCTTCCCCGGGGCCCGCAGAGGCCGGTGGGTGGGGGTGGGCCCTGGCCCTGCAGAGGCCGATGGGTGGGGGTCGGGGTGGGCTCCAGCCTGGAAAGGGCCTGGGAGTGTACAGGGG
GCCCAGACTGAGGGGGTGCCAGGCCCCCGACTCACACACCTTGGCCGCCACAGGAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCCGCGGGCTACAACGTCAAATTCGATATGTTCA
GCAAGATCTGCGTGAACGGGGATGACGCCCACCCGCTGTGGAAGTGGATGAAGATCCAACCCAAGGGCAAGGGCATCCTGGGAAA
GTGCGTGACCTCTGGGGACAGTACGGCTGCCGGGG
TGGGGGTGGGGGGGCTGCTGGGATGCTCACACCTCCCTGGGGCAGAATGGCTCGGGGGGGGGCGGTTGCGGGGAGGTGCTGGGACTCTCACATCGAGTGGCCTCCTGGGGGTAAGATGGC
TCAGGGGGACATAGAGGGCTGTGGAGGCAACCAGGGATGCCCACACCTTTGTGGCCTCCTGGGGACAGGATGGCTCGGGGGCCTGTGGGGGGCTGTTGGGACTCTCACACTGCATGGCCT
CCTGGGGTAAGATGGCTCTGGGGGGCCTTGGGGGCACTGTGGCTGTGGAGGCAGCCGGGGAAGCTCACACCCTTGTGGCCTCCTGGAGACAGGACAGCTTGGGGACTGTGGGGGGCTGCT
GGGGACGCTCACGTCCATGTGCTTCTTTTCCAGTGCCATCAAGTGGAACTTCACCAAGGTAAGGGGGCTGTGGGGGGTAGGGGACCAGCTTCCCCTGGCCACAGCCGTGGCCCAGATGGG
CAGCGGGCAGGAAGGGCAGCCTCAGCCCCTTGCAGGGGTGGCCCCACAGTTTGGACACCGTCTCTCCACAGTTCCTCATCGACAAGAACGGCTGCGTGGTGAAGCGCTACGGACCCATGG
AGGAGCCCCTG
GTAGGTCCTCTCTAGGGAGCCCGCTTGAGGCTCGGGGGCTTGGGAGGTAGCTGCCCTAACTCAGCTTTCCTCCCCGACAGGTGATAGAGAAGGACCTGCCCCACTATTT
C

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCTCGGCCGCCTTTGCCGCCTACTGAAGCCGGCGCTGCTCTGCGGGGCTCTGGCCGCGCCTGGCCTGGCCGGGACCATGTGCGCGTCCCGGGACGACTGGCGCTGTGCGCGCTCC
ATGCACGAGTTTTCCGCCAAGGACATCGACGGGCACATGGTTAACCTGGACAAGTACCG
GGGCTTCGTGTGCATCGTCACCAACGTGGCCTCCCAGTGAGGCAAGACCGAAGTAAACTAC
ACTCAGCTCGTCGACCTGCACGCCCGATACGCTGAGTGTGGTTTGCGGATCCTGGCCTTCCCGTGTAACCAGTTCGGGAAGCAG
GAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCC
GCGGGCTACAACGTCAAATTCGATATGTTCAGCAAGATCTGCGTGAACGGGGATGACGCCCACCCGCTGTGGAAGTGGATGAAGATCCAACCCAAGGGCAAGGGCATCCTGGGAAA
TGCC
ATCAAGTGGAACTTCACCAAG
TTCCTCATCGACAAGAACGGCTGCGTGGTGAAGCGCTACGGACCCATGGAGGAGCCCCTGGTGATAGAGAAGGACCTGCCCCACTATTTC

Retrieve as FASTA