Entry information : PtroGPx03
Entry ID 6572
Creation 2009-02-04 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-28 (Christophe Dunand)
Peroxidase information: PtroGPx03
Name PtroGPx03
Class Animal glutathione peroxidase    [Orthogroup: Gpx1001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtroGPx03
start..stop
S start..stop
HsGPx03 468 7e-171 1..226 1..226
PpyGPx03 463 3e-169 1..226 1..226
HlGPx03 431 2e-156 1..226 1..226
MmulGPx03 427 5e-155 1..226 1..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 152999996..153000082 87 N° 2 153004667..153004820 154 N° 3 153006228..153006345 118 N° 4 153006760..153006859 100
N° 5 153007243..153007461 219  
join(152999996..153000082,153004667..153004820,153006228..153006345,153006760..1 53006859,153007243..153007461)


exon

Literature and cross-references PtroGPx03
DNA ref. GenBank:   NC_006472.2 (152999996..153007461)
EST ref. GenBank:   DC527697.1 [Fragment]
Protein sequence: PtroGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226 (202)
PWM (Da):   %s   25257.86 (22742.5)  
PI (pH):   %s   7.44 (6.52) Peptide Signal:   %s   cut: 25 range:25-226
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASY*GLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 4 introns ) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTTTCCCTGCTCCTGGCCGGCTTCGTCTCGCAGAGCCGGGGACAAGAGAAGTCGAAGGTGAGTGAGCCTCCGGGCCGGGGGCCGGGAGAA
AAAACCTAGCCCCTCGGTGTCCAGCGCTCAGTGCAATGCACCCCTTTTCCCAGGCTCCCCGCCAGATGGGCAATCCCCAGGTGCGAGGGACCTCCTGAACCCCTTTTGCCGCCCCCTCCG
CCGCCGGGACCCCGCCCCCGACCGCCGTGGTCTCGTAGTTCCATCTGTTGGAGAGCCGAGACCTGGTGCTTCAGGCGGGCAGAATGACTAAGGGAGGAAGGTCTCTCTCCCCGAGCTCGC
ACTTTCTCCCCACTGCCACCTCGAGGGTCGCCTTGCTACATCTATGTCACCTCCGTGCCTGAGCTGCTCCCCTTCAGTAGGGCCTAAGAGGGAGGGCGTCACAGAAAAAAATGCCCAGCG
TCTGGGTGGGCTGTGCAAGTTCCCAGGGAGAGAGACAAGGAGAAAGGAGAGAGGCAGCTGGGTGGTCCTGGTCCTGAAGAACTGCTGTGGGGGGCTCTTCTACCCCAAGAATGATACAGG
CAGGTAGAAATGGCCACTTGGATTCAGGGCATTGGTAGAAGAGGCAGAGATCTGTGCTAGAAAGAGCTCTGGAGTGACAGTGCAGAACACTCAGGACCCTGAGTCCTTACCTGCTCCTGG
ACCCCCGTTTCTCCATCTGCAGGGGGGAGTTTGGGGGTGGGAGTGCATGGGGCACAATGAAGCTGAGGGCCTCAGAGGGGATGCTTGGAGAAGCTGAAAAATCCACAAGCTGTTCTCTGA
AATTTCCTCCCCTGGGGCAGCCTCACTACCCAGGACCCACTGTCCTCATTAGCCTGAGGAAACCTGGTAGTTGGAGAAAGCTGGGGACTGCTAATTCAGAAGAAGAGGTAGAATTCTCTA
GAGCCTCAGTCTATTTCCAGCAGGTGTGTGGCCCATACCTGGAGTGGGGATACTGAGGCCAGGAGTGGGATGACCCAGCATGCTTATCTCCTTTGACAGTATGTGCTGGGGTGGGCTCTG
TAGACCTCTCCTCTACCCAGGGAGTGGGAGTGGGTGGGGAAGGAGGCAGAAGCCAGGTGTAGGGATAGACTCAGAGAGAGCGATTTCTGTCTCCAACTTCCCAACATGCATAACTCACAT
TTTTGCAAGCTCTGAGCTTTTGTTTTTAAAATCCTCTGGGTCTTCACTTTAATTAAGATCTTATGAGTCTAGGATTCCGTTTCCAAAATTCTGTCCACTTCTCAGGAAGCCCATTGGAAG
CACAGGGTTCCTTCCATGTTACTCACCCCTTTTCGGTCCTCAGCCTAAATCCCATTAATCAGCCTCTCCTTGGAGTCAGTCTAAATGGATGTGAAGCCACTTCGTCCAAGTCCGCTCCTT
TTTATCCATCCCTGTTCATAATCCCCAACTCAGAAGGCATTTTCCAGGTCAGGAATGGGATCGATTTTCAACATTGAGGTTTGGGGTGGGCCATAGACAGGCCAGCACCGTGGAGTCAGT
CCCAACCTCTCAGTTTTGGAAGGGTCAAAGAAGATACAATTGGGCCCCGCCTCAAGAAGGCTAGTGGGGAGAACGTGGACTCCATGAATAACTCATCATAGCTGTGTCTTCTCTGCAGCA
CTCTGGGGAAGGATAAATGGACTCACAGAGAATAGGATGGGGATGGTCTAGAAAAGTTTTAGGGTGAGGTGTGATCATATCACATACAACCAGTCAGGACTTGCTGGCTAACGAAAGCCT
GGGCATGCCCATCTCTGCTCCCAAGTTCTTAGAGTTCAGATGTCTTAGCTCTGGGTTAGGACCCAACCACTCACCTTACCCCCAACCCCAGGGTAAAGAGATAGGGTTATGGGGCATGTG
GAGAATGGAATGGACGAAAGGTGACTCAGCCCCAGAGAGGTGTTTTCCTCCTACCAATTGAAAGGGAGATGCTAGGGAAGAGACCAGGTCCTCCTCTTCTTGCTGCGTCACCTCCCCAGT
CCAACTTCAGGCTGCCCACGCTCCTTGTCTCTACAAAAGGACTGCAGAAGCCGGAAAGAGTGACAACTGCTGACGTGCACGGGATCCTAGTAACTGCTGGTTTCTAGGTGACTAAACCTG
GCAGAGAGAATCATGGAACCACAGGCTGACAGAGTTAAAGGGCCCTTAAGACAGCCCTGAACCTGACTCCATCTTACAATGGAGGAGCTGGAGCCCCAGCAAAGGGGGTCACATGGCATC
AGAGACACAGCAAAGCCCAGCACTCAGGTCTCCTGACTCCCAGACCACTTCTCACAGCATCATATTGATAGGAGTGATAAGACGGGAGAGGAGAAAGACACAAGACCAGCAGCCCCAGCC
AGCCAGAGTCCTGGCTGAGTCCCATCATCCAACTCTCAAGCCATCGGAACCCTCTTCTCTTGCCCGGCTGTGGGAGGATTCAGGCACCCTCATGGCCTCTCCCCTTATCTCCTCTGGCCA
CTGTTTCAGATGCGGTGCTCTGGGATTCCACGTGCCCAGAGAAGGGAAGGGGGCTCATAGAGGACTGAGTTGCAGTGATCAGTGGTGAGCACAGCCGTGGCTCTCCACCCATGGGCCACC
TTCTGACCTCCACTATCCCTTGACATGAGATTTCGTTCCAAGAGACTCCAGGCCTGTTTTGCTCTGCCAGCAGATTCCCACAACCATTTTGGGCAGCAGCATGCTTATCTCCCTGGACAT
ATGCCCAGACAGTGTAAGTGACTTGCTCAGGGCCACGCAGCCAGCAAAAAATAGAACCTAATGAAATAGGGTTCTCCTTGCCACACCCCCAAGCTGAAACTGTGCCCAGAAGCTGGTCCT
TCTGTTTACAAGTTCCCATTATTAGGACAACCTGTAATCTTTTTTTCCTCCATGTCTCAGTTCATTTTTGGATCATGGCAGAGTTAAAAAAGTGGAGAGGCTATAGACATGCCTGGCTTT
CTGGCCACTAGATCTTTGTGGCGGTCTAGGGTGTATTTGTTGTGCCCCAGTTTGTCTGCATTTTAAGGCGGAACTGGCCCTGGCTGGGAACGAGGAGGCCCAGGAGCAGTAGGAATGTTG
ATCTTAGGTCTTGGGCCTGCCTCCAGCACCCACCAAAAGTCACAGGATGTGGAATATTAGACTCATGTAAAGCAGGAAGTTTGCACCAGAGCCAAGAAGAGAGCTTGCAGCTGCCAGGGA
ATGGCCTGGCGGAGGAAGCGCAGCCTCGCCCAGCTCAGCAGACCTGCTTCATGACAGAGGCAGCTCTTCTGCACTCTACTGGGGCCACGCCCTGCCAGCATATATCACTCCCTTCACCTG
GTCAGGCCCAGGTACCTTGCCTCAACAGCAAGTTCTCCAGAATTGAGGGGAAGAGAGGGGGTGAATTTGCTTCTCTAACTCCAGCCACCTGTCTCTGCCCTCTCCTGGTCTATAATGCTA
CTTTGCATTCCATTTGTTTATTGTCTGCCCACCTCTCAAAGGATATCAGGGCCACAAAGGACCTTAAAGACCACCTTATAAAATGGTTTCAAGGTTTTTCCTTTCCCATCACGACCAGCC
CACCTGCCAAATTGTGTCAATGATGCAATGACATCCTTTCAAGAGTAGTCTCAGAGTTTTGTTGTCTGTGTCACGGGCAGAGTAGGCTCATAGGCCACATCCTACTAGCCAGCAGTGGCC
CCAATCCCCCCTCTCCCACTGATCATGATCCTATCAAGCCATCATGGTTGACCTGGTTGAAGAGTTGGTTCAGTTCAAGGTTCTCATTTTACAAATGAGGAAACTCAGGTCCGAAGAAAA
GAAAGGGGCAGTCCAAGACCACACAGGGAGTTAATGGCAGAGGGACATGGAGCCCAGGTCTCCCAGCCCACAGTCCACTGCACTCTGTCCCTCCTTGTCCTGGAGGCTGACTGTGAGCAG
CAGCTGGGGAGGAAGGCATAAGAGTCATCACCAGCCTGCTCAGACCCGGAACATTAACACATGCAGGTACTGTTGCTTTTCCCTACCTCACCACAGCCCTTTCCCCCATGCCTGGCTCTC
AGTCCTGCTTCCCTGTTTGGTAAGAACAGCCTCATCTTTCCTGTCCTGCAGATTGGGAGCCTCTGAATCACCATGTCCATACTGCCTCTTCCTCTCTGTTCAGTTTTTCCTTCACACTGG
CCTAGTTCAGGTTCTCATCCTCAATTGCCTGGATTATTCCAACAGCCACCCAACCAGTCTCCATCAGCCCGTCTAGGAACCCAGTCATCAGCTTTAGGGCAGTCTCCCTGAGAGCCCAGT
AAATGTTCTGAAATTGACATGTGATGTGGAAGTAATTAGCAAAATAAGTCATTCTCCAGGGTTCCATAGCACTCACTTATTAAGTGCTTAATATTAATAAGTGCTTATTAGGTGCTTAAT
AAGTGCTTTTTAAGCACTTAATATTAAGTACCTGAAAAGCACTTATTAAGTGCTTTCATAATCATTATCTTAAACAAGGAATTAGGAGACGTCAGTGCTAGTCCAGTTGCAATTCTCGGT
GATTATTTTGAGAAAGTCACTCTCCCTGTTGGGATCTTTCATTCTTTTGAAAACGGAGATGTCCAAGTTCCTTTCCAGCTCTAACTGCTCCTTTTATGGCCTGTGTTCCAGATGGACTGC
CATGGTGGCATAAGTGGCACCATTTACGAGTACGGAGCCCTCACCATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTATGCTGGCAAATACGTCCTCTTTGTCAACGTGGCCAGCTAC
TGAGGCCTGACGGGCCAGTACATTG
GTAAGAGCCCACCCTTCCTCCCTGCTTTATTTGGGGCTGTATGGCATATTTCAATCACAGGAGCTTTTCTGGTGCATGGGGGAAAGGGTGATGGC
AATCACGAGAGTCCAAGCCCCTTTTCTCAGCTCCACTGTGTTCCGTGGTTTTGTGAAGATGATTATATAAGCCTGAGGTCTGATTGCCTTTGGACATGTTCTAGGAGATTCCTAGTTATC
CTTCTTCATCTCTGGGCACCTCAACAACCCTAAAGGCAGAGGGATAGAGATTAGGTTTGTGCTTAGAACTCCCTTTGGCTGGAGCATGAGATGGTAACTGAAGCTCCATCTTGCTGAGAA
TATCTCATTTTCCCTCAGCCCCATCTGCTTTGGTGCTTCTCTTGGCAGCTCTCTGGAAAGCAGGCAATTGCCTCGAGGTCCCTGAGTGTATGCGTGGTGTAGCGGGATGAAGGAGCAGGC
TACACTTCTAATGCCCATTCTAAAATAAACTTTGAAGATGATCTAGTTTAGCCTTCCCCTCTTCTCAATTTACAGATGGGAAACCAAGACTCAGAGCGAAGATACAACTTAAAACAGAGT
CACAAAGCTATTAGCGGTGGAATGGGGCATTTGGCCCAGGTTTCATGATCTCCTGATATGCTTACTCCTTTCTCCCTAGCTGGGGTAGAATACAGAGGCTAGGGGAACAGGCAACCAAAG
GCAAGCGACAGCACCCAGGGGAAAACGCTTTGGGGCTGAGCAGTCTACTGGCAGGGGGTCAGGGAGGCAAGGGCAATTTGACCCTCCATGCTCTGCCTGGCAATCACAGGCGAATTCCCG
GAAGTGAAAGGACGGCGGTCACGTGGCCCAGTGGCTGTGAGTGCTTTGTCTGGGATGCTTCTCTCTAGCCTTGGAACAGAGCAGAGTGCGTTTGGGCAAGAGATGGGCTGGGTGCTGCTG
CAAAAGAGACCAGGGGACACTGAGGACACTGGGGAGCTGGGCCAGGGCCTCATCTGTGTTCCTGATTTGCCAAAGATTATGGGAGGGTTGTAACCTCACCCCAAAGAAGTTCTCTGCCTT
GTATCCAGGGATGGATAGTTCTTGCTCCAGGAAACTCAATCCTGAGGGTCCTGAATGAGTGCTCTAGCTGGCCCAGGTGGAGGGCCTTGGCAATGGGCAGGTGACTGACAGCTGACTTGA
GGAAGGGTATTATTCTTGTCCTCCAAACCTCCAATCCATCCAGATTAGAGTCAAGAGGATAGGACCTGAGTCCCAGCATTGCCGTGAACTCACTGGTGATCTTGCGCAAGTCCCTCCCTT
TCTCGGGCCTCAGTAGTTCCAGCGGCACAGCGGGTGAGCCGGGGGAGTGGTGTGGATGAGACAGGGCTCCTCGCCAGGATACTCCCATGTCTGCTCTTTCTCTTTGGCCCAGAACTGAAT
GCACTACAGGAAGAGCTTGCACCATTCGGTCTGGTCATTCTGGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGAGAGAACTCAGAGATCCTTCCTACCCTCAA
GTGAGTGCTC
ACTCAGCATCCTGAGAAAGCTCCTCTCACATGGCCCACGTCTTGTTATCAACCCCAATTCATGGTGGACATTTCTCGGCCACCAAGAACCACTCTCCTCTTCTAGGATCCCCAGTGGAAT
GAGGGAAGGGAAGGGACAAGAGAGGGAGAAGGACAGGGACAACTGGTTGTGATGTGCATCCGCAGGGAGCACCAAGGTTGGGGGACACTGAAAAGGGACCAGGCTGGAAAGGAAGACCGT
GGACTCACATTATGCCTATGCCCACTGCACATTCACTGGCTCCTGCTGCCCACTGCAGAATAAATCCAGACCCCCAACACCCTCTCCCCTGTTCTGTCCCTTCCTCTCATTTCTGAGCCC
TGTGCCCACCTCCTTGGGACCCACCTAAGAACATTTCTCAACAGGTATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTCAATGGAGAGAAAGAG
CAGAAATTCTACACTTTCCTAAAG
GTAAGTGAGCTGCCACCTGTGCTGGCTGGGGCTGCAGCCCCTCCTGGCTCCAGCCCACAGCGTCAGGGCCCATGCCACCTCCCCTGCTCCTGGGCT
CTTGGGGAATTTCTTGGCACCTGACTATTGTTCCAACTAGAGGGCTCTGCAGACCCTGACTAGGGTCTCCTTGGCCCATTTTACAGAAAGGCCCAGAAGGACCCAGAGTGAACATACTAA
GGGTCTCACAATCTTCTAGAGCCACAGCTGGCGCTGGCAGTCTTCTAACTCCCAAACTGGGGCTCTTCTCTCAGGGCCAGGCTATTCTCCCACCCCAGGAAGGCCTGGGAAGGAAGAGGG
TCAGGGGGCCTCAAGCAAGGTTGACACTCCTCTCATCCCTGCTCTAGAACTCCTGTCCTCCCACCTCGGAGCTCCTGGGTACATCTGACCGCCTCTTCTGGGAACCCATGAAGGTTCACG
ACATCCGCTGGAACTTTGAGAAGTTCCTGGTGGGGCCAGATGGTATACCCATCATGCGCTGGCACCACCGGACCACGGTCAGCAACGTCAAGATGGACATCCTGTCCTACATGAGGCGGC
AGGCAGCCCTGGGGGTCAAGAGGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTTTCCCTGCTCCTGGCCGGCTTCGTCTCGCAGAGCCGGGGACAAGAGAAGTCGAAGATGGACTGCCATGGTGGCATAAGTGGCACCATT
TACGAGTACGGAGCCCTCACCATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTATGCTGGCAAATACGTCCTCTTTGTCAACGTGGCCAGCTACTGAGGCCTGACGGGCCAGTACATT
G
AACTGAATGCACTACAGGAAGAGCTTGCACCATTCGGTCTGGTCATTCTGGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGAGAGAACTCAGAGATCCTTCCTACCCTCAAG
TATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTCAATGGAGAGAAAGAGCAGAAATTCTACACTTTCCTAAAG
AACTCCTGTCCTCCCACCTCG
GAGCTCCTGGGTACATCTGACCGCCTCTTCTGGGAACCCATGAAGGTTCACGACATCCGCTGGAACTTTGAGAAGTTCCTGGTGGGGCCAGATGGTATACCCATCATGCGCTGGCACCAC
CGGACCACGGTCAGCAACGTCAAGATGGACATCCTGTCCTACATGAGGCGGCAGGCAGCCCTGGGGGTCAAGAGGAAG

Retrieve as FASTA