Entry information : PblGPx01
Entry ID 6614
Creation 2009-03-03 (Christophe Dunand)
Last sequence changes 2009-03-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: PblGPx01
Name PblGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PblGPx01
start..stop
S start..stop
McirGPx01 233 2e-80 1..159 1..159
PblGPx02 213 2e-72 1..159 1..159
UramGPx01 203 3e-68 4..159 12..167
CangGPx01 200 3e-66 2..159 69..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1619450..1619524 75 N° 2 1619589..1619724 136 N° 3 1619921..1619938 18 N° 4 1620006..1620063 58
N° 5 1620222..1620290 69 N° 6 1620364..1620391 28 N° 7 1620477..1620572 96  
join(1619450..1619524,1619589..1619724,1619921..1619938,1620006..1620063,1620222 ..1620290,1620364..1620391,1620477..1620572)


exon

Literature and cross-references PblGPx01
DNA ref. JGI genome:   scaffold_5 (1619450..1620572)
mRNA ref. JGI transcript:   77183
EST ref. GenBank:   EX861895.1 [3' end]
Protein sequence: PblGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159
PWM (Da):   %s   18563.46  
PI (pH):   %s   9.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTCLFNYQIKDIKRNEWNLEELRGKVVLFVNVASKCSFTKQYDSLENIYNTYKHRGLVVVGCPCNQFANQEPGTEEEIHTFCRLTYNVSFPLTSKIEVNGKGEHPVYRFLKDSQPGFLGLRRVKWNFKFLINREGKVVKRFFTFTDPKSITNEIEKCL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTGTCTTTTCAATTATCAAATCAAAGATATCAAGCGGAATGAGTGGAATCTGGAAGAGCTGAGGGGAAAGGTACAAAAACAACAACAACAACAATAGTAATAAAAATGAAATAAC
AATTCTATACATACAATAGGTTGTCTTGTTCGTCAATGTGGCATCAAAGTGTAGTTTCACGAAACAATACGATTCTTTGGAGAATATCTATAATACATACAAACACAGAGGACTAGTAGT
GGTTGGCTGTCCCTGTAATCAATTTGCAAATCAAG
GTAAAAAAAATACTAACAATAATTTTTACATATAAAATTGTAGATAGCTACTCGATCTGCTCTTCACTTTTTATATATATAAATA
AAAGAAAAAAATTCAGCATTTACTTTACTTTTCTTTACTAATTAATGCTTATTGACGTTTTGTATGTACATGTACATGCATAATTCTCTTTTAATAAACTAATCACTTTAGAGCCAGGAA
CGGAAGAAG
GTATAGACATATACATATAATATATTCATATAATTGAAGAAGGAATATTAACTTACTTTTGTCACAGAAATCCACACCTTCTGCAGACTCACTTACAATGTCTCATTTCCA
CTGACCTCAAAAAT
GTATGATTTTATTTCTCCAAAAACGAAAAAAAAAAAAAAACACGAAAACAAAATATGGGACCTGGACCTCTGGGGTGATTTATGTTTCTCAGGCCCATGAAATATA
TATATATATACTTTAACTCTAATCCTTTTATATCTATATATAACATAAATAGTGAAGTAAATGGTAAAGGCGAACATCCAGTCTACCGATTCCTAAAGGATTCACAACCGGGATTTTTAG
G
GTGAGTTCAAATATACATTTGTTTATATATATATATATATATATAACTTACAGTTTTTTAAACTTATTTGTAGATTGAGACGAGTCAAATGGAATTTTGAGGTAAAGATAATACAACAC
CTATTCGCTTATCATAAATGTACACATATGTACTAGGTCTCTAATCAATATAAAATATATCATATAGAAATTTCTTATCAATCGCGAAGGCAAGGTCGTCAAACGATTCTTTACATTCAC
AGATCCAAAGTCAATTACCAACGAAATCGAAAAATGTCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTGTCTTTTCAATTATCAAATCAAAGATATCAAGCGGAATGAGTGGAATCTGGAAGAGCTGAGGGGAAAGGTTGTCTTGTTCGTCAATGTGGCATCAAAGTGTAGTTTCACGAAA
CAATACGATTCTTTGGAGAATATCTATAATACATACAAACACAGAGGACTAGTAGTGGTTGGCTGTCCCTGTAATCAATTTGCAAATCAAG
AGCCAGGAACGGAAGAAGAAATCCACACC
TTCTGCAGACTCACTTACAATGTCTCATTTCCACTGACCTCAAAAAT
TGAAGTAAATGGTAAAGGCGAACATCCAGTCTACCGATTCCTAAAGGATTCACAACCGGGATTTTTAGGATTG
AGACGAGTCAAATGGAATTTTGAG
AAATTTCTTATCAATCGCGAAGGCAAGGTCGTCAAACGATTCTTTACATTCACAGATCCAAAGTCAATTACCAACGAAATCGAAAAATGTCTATGA

Retrieve as FASTA