Entry information : PblGPx02
Entry ID 6615
Creation 2009-03-03 (Christophe Dunand)
Last sequence changes 2009-03-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: PblGPx02
Name PblGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PblGPx02
start..stop
S start..stop
McirGPx01 257 1e-89 1..159 1..159
UramGPx01 225 6e-77 2..159 10..167
SpuGPx01 221 1e-74 2..159 55..212
SAcoGPx01 216 2e-73 3..159 6..163
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1402265..1402339 75 N° 2 1402456..1402591 136 N° 3 1402705..1402722 18 N° 4 1402776..1402833 58
N° 5 1402905..1402973 69 N° 6 1403063..1403090 28 N° 7 1403159..1403254 96  
join(1402265..1402339,1402456..1402591,1402705..1402722,1402776..1402833,1402905 ..1402973,1403063..1403090,1403159..1403254)


exon

Literature and cross-references PblGPx02
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M. and Lindquist,E.A. DOE Joint Genome Institute Phycomyces blakesleeanus EST project.
DNA ref. JGI genome:   scaffold_1 (1402265..1403254)
mRNA ref. JGI transcript:   29315
EST ref. GenBank:   EX853435.1
Protein sequence: PblGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159
PWM (Da):   %s   18026.21  
PI (pH):   %s   5.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTLYDFTIKNIKNQDWNLESLKGKVVLIVNVASKCGFTKQYAGLEELYKNYKDKDFEIIGVPCNQFGGQEPGTEEEIENFCTLTWSVTFPLAAKQDVNGDHESPLYAWLKDSQSGLLGMKRIKWNFKFLIDKEGKVVNRYSSLTEPKAIAADIEKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 91 ESTs. Strain="NRRL1555".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTCTTTACGATTTCACCATCAAGAACATCAAGAACCAAGACTGGAACTTGGAATCTCTCAAGGGAAAGGTAATAATGATAATGATAATGATAATGATAATCTGTCTATTATCT
TCTTTTGTTGATCCTTTTTTGCTTTGCTTTGCTTTGCCTTGCCTTGCCTTGCCTTGATTTACATTGATTAGGTTGTCCTTATTGTCAACGTTGCTTCCAAGTGCGGTTTTACCAAGCAGT
ATGCTGGTCTCGAAGAGCTCTACAAGAACTACAAGGACAAGGACTTTGAAATTATCGGTGTTCCCTGCAACCAGTTTGGTGGTCAAG
GTAAGAATCGCAAACACAAAAGTGGATTTAAAA
AAAAAATAAGAATAAGAAGAGGAATAAAGAGATGGTAATTTATATAAACTTATACTATCTCTGATTTACTTTTCCTTTAGAACCTGGAACTGAAGAGGGTAAGTCTAGATCAAATTGATT
ACGATTATGCATTGTCCTAATAGTTTGTTAGAAATCGAGAACTTCTGTACTCTCACCTGGAGCGTTACTTTCCCTTTGGCCGCTAAGCAGTAAGTTTAAACCATGACAACTCGTTTTTTT
TTGAAAGTTTATCGGTACTTATCAAGTGGAATTGGTATAGGGATGTCAACGGTGATCACGAGTCTCCTTTGTACGCCTGGTTGAAGGATTCCCAATCTGGTCTTCTTGGGTAAGATTTAT
TTATAAAGAGAGTAGATATTTTGTATTGGGTTTTCTTTTTATTGACACGAACTTTTTTCTTTGGGGGTGATCTTATAGAATGAAGCGTATCAAATGGAACTTTGAGGTAAGATATAATAA
AGGCTCTGGAGCTTAAAAGATTATTATTTGAAACTAATACTATATCTATTTTAGAAATTCTTGATTGATAAGGAAGGAAAGGTCGTCAACCGTTACTCTTCTCTTACTGAACCCAAGGCC
ATTGCTGCTGACATTGAGAAGCTTTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTCTTTACGATTTCACCATCAAGAACATCAAGAACCAAGACTGGAACTTGGAATCTCTCAAGGGAAAGGTTGTCCTTATTGTCAACGTTGCTTCCAAGTGCGGTTTTACCAAG
CAGTATGCTGGTCTCGAAGAGCTCTACAAGAACTACAAGGACAAGGACTTTGAAATTATCGGTGTTCCCTGCAACCAGTTTGGTGGTCAAG
AACCTGGAACTGAAGAGGAAATCGAGAAC
TTCTGTACTCTCACCTGGAGCGTTACTTTCCCTTTGGCCGCTAAGCA
GGATGTCAACGGTGATCACGAGTCTCCTTTGTACGCCTGGTTGAAGGATTCCCAATCTGGTCTTCTTGGAATG
AAGCGTATCAAATGGAACTTTGAG
AAATTCTTGATTGATAAGGAAGGAAAGGTCGTCAACCGTTACTCTTCTCTTACTGAACCCAAGGCCATTGCTGCTGACATTGAGAAGCTTTTGTAA

Retrieve as FASTA