Entry information : UmPrxII
Entry ID 6616
Creation 2009-03-05 (Christophe Dunand)
Last sequence changes 2009-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: UmPrxII
Name UmPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Ustilago
Organism Ustilago maydis    [TaxId: 5270 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value UmPrxII
start..stop
S start..stop
SrePrxII 335 2e-120 1..171 1..171
AthiPrxII 188 3e-62 3..171 6..172
SlutPrxII01 184 1e-60 1..171 4..172
SbrePrxII01 184 2e-60 1..171 4..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 102990..102992 3 N° 2 102782..102947 166 N° 3 102340..102686 347  
complement(join(102340..102686,102782..102947,102990..102992))


exon

Literature and cross-references UmPrxII
Literature Chen,F., Carrick,B., Zeng,K., Gnirke,A., Cheung,L., Chong,A., Goldschmidt,S., Hussain,S., Laufer,A., Oliva,J., Park,C., Wong,M., Amundsen,C., Orton,A., Shao,A., Platt,D. and Swimmer,C. Exelixis USTITAG project
DNA ref. JGI genome:   contig_1_101 (102992..102340)
EST ref. GenBank:   EB748648.1
Protein sequence: UmPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18187.34  
PI (pH):   %s   5.59
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAISKGEQIPNTTFTYVPWAPELADGTACGAPTKIQTHEAFKGKKVVIVAVPGAYTPTCHVNHIPPYIKQIDSFKSKGVDQVIVLAQNDPFVMSAWGVQNKAEDKVIFATDLNLEFSKAIGSIADLSAMGFGQRTGRYALIVDDLKVVDFSPEPNPGAVEVSGADHVLAKL

Retrieve as FASTA  
Remarks Complete sequencw from genomic (chromo 7, 1 intron) and 28 ESTs. Strain="521"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCGTCGATGCGTTCGTTTGCAACAACGTCGGTTCAAAAGGCTATTTCAAAGGGCGAGCAGATTCCCAACACCACCTTTACGTACGTCCCCTGGGCACCTGAGCTCGCTGACGGT
ACCGCTTGTGGTGCTCCCACCAAGATCCAGACACACGAAGCTTTCAAGGGCAAGAAGGTCGTCATTGTCGCCGTTCCCGGTGCCTACACTC
GTAAGTATTGCGCGCACTCTTTGCTCACC
ATTCTCCCTCGAAACCTTGGCTAACGATTTTCCTTTTTTTCCGGACCGCCTCCTTTTGCTCACTAGCTACGTGCCACGTGAACCACATCCCACCCTACATCAAGCAGATCGACAGCTTCA
AGTCCAAGGGTGTCGATCAGGTCATCGTTCTGGCTCAAAACGACCCGTTCGTCATGTCCGCCTGGGGCGTCCAGAACAAGGCCGAGGACAAGGTCATCTTTGCCACCGACCTCAACCTCG
AGTTCTCTAAAGCCATCGGCTCTATCGCCGATCTCAGCGCCATGGGCTTCGGTCAACGTACCGGCCGTTACGCCCTCATTGTGGATGACCTTAAGGTCGTCGATTTCTCTCCTGAACCTA
ACCCCGGCGCTGTCGAGGTTAGCGGCGCTGACCACGTCCTCGCCAAGCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTTCAAAGGGCGAGCAGATTCCCAACACCACCTTTACGTACGTCCCCTGGGCACCTGAGCTCGCTGACGGTACCGCTTGTGGTGCTCCCACCAAGATCCAGACACACGAAGCT
TTCAAGGGCAAGAAGGTCGTCATTGTCGCCGTTCCCGGTGCCTACACTC
CTACGTGCCACGTGAACCACATCCCACCCTACATCAAGCAGATCGACAGCTTCAAGTCCAAGGGTGTCGAT
CAGGTCATCGTTCTGGCTCAAAACGACCCGTTCGTCATGTCCGCCTGGGGCGTCCAGAACAAGGCCGAGGACAAGGTCATCTTTGCCACCGACCTCAACCTCGAGTTCTCTAAAGCCATC
GGCTCTATCGCCGATCTCAGCGCCATGGGCTTCGGTCAACGTACCGGCCGTTACGCCCTCATTGTGGATGACCTTAAGGTCGTCGATTTCTCTCCTGAACCTAACCCCGGCGCTGTCGAG
GTTAGCGGCGCTGACCACGTCCTCGCCAAGCTCTAA

Retrieve as FASTA